SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSFCAP00000010747 from Felis catus 76_6.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFCAP00000010747
Domain Number 1 Region: 669-803
Classification Level Classification E-value
Superfamily Second domain of Mu2 adaptin subunit (ap50) of ap2 adaptor 0.00000068
Family Second domain of Mu2 adaptin subunit (ap50) of ap2 adaptor 0.018
Further Details:      
 
Weak hits

Sequence:  ENSFCAP00000010747
Domain Number - Region: 408-413
Classification Level Classification E-value
Superfamily Formin homology 2 domain (FH2 domain) 0.0118
Family Formin homology 2 domain (FH2 domain) 0.13
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFCAP00000010747   Gene: ENSFCAG00000011575   Transcript: ENSFCAT00000011581
Sequence length 824
Comment pep:known_by_projection chromosome:Felis_catus_6.2:C1:54159988:54272253:1 gene:ENSFCAG00000011575 transcript:ENSFCAT00000011581 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GLKKRTRKAFGIRKKEKDTDSTGSPDRDGIQPSPHEPPYNNKAECAREGGKKVSKKSNGA
PNGFYAEIDWERYNSPELDEEGYSIRPEEPGSTKGKHFYSSSESEEEEESHKKFNIKIKP
LQSKDILKSAVTVDELKASIGNIALSPSPVVSGVYAKGAIKRNLSSEEVARPRRSTPTPE
LTSKKPPDDTTALAPLFGPPLESAFDEQKTEVLLDQPEIWGSGQPINPSIESPKLTRPFP
TGTPPPLPPKNVPATPPRTGSPLTVAPGNDQSATEVKIEKLPSINDLDSIFGPVLSPKSV
AVNAEEKWVHFSDTSPEHVTPELTPREKVVSPPAASDNPSDSPAPGPPGPPGPPGPSGPP
GPPRNVPSPLNLEEVQKKIAEQTFIKDDYLETISSPKDFGLGQRATPPPPPPPTYRTVVS
SPGPGSGSGTGTTSGASSPARPATPLVPCSSTTPPPPPPRPPSRPKLPPGKPGVGDVPRP
FSPPIHSSSPPPIAPLARAESTSSISSTNSLSAATTPTVENEQPSLVWFDRGKFYLTFEG
SSRGPSPLTMGAQDTLPVAAAFTETVNAYFKGADPSKCIVKITGEMVLSFPAGITRHFAN
NPSPAALTFRVINFSRLEHVLPNPQLLCCDNTQNDANTKEFWVNMPNLMTHLKKVSEQKP
QATYYNVDMLKYQVSAQGIQSTPLNLAVNWRCEPASTDLRIDYKYNTDAMTTAVALNNVQ
FLVPIDGGVTKLQAVLPPAVWNAEQQRILWKIPDISQKSENGGVGSLLARFQLSEGPSKP
SPLVVQFTSEGSTLSGCDIELVGAGYRFSLIKKRFAAGKYLADN
Download sequence
Identical sequences ENSFCAP00000010747

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]