SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSFCAP00000010759 from Felis catus 76_6.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFCAP00000010759
Domain Number 1 Region: 209-270
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.00000000000000433
Family LIM domain 0.0084
Further Details:      
 
Domain Number 2 Region: 267-336
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.00000000143
Family LIM domain 0.021
Further Details:      
 
Weak hits

Sequence:  ENSFCAP00000010759
Domain Number - Region: 178-207
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.00156
Family LIM domain 0.062
Further Details:      
 
Domain Number - Region: 106-221
Classification Level Classification E-value
Superfamily Formin homology 2 domain (FH2 domain) 0.00654
Family Formin homology 2 domain (FH2 domain) 0.13
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFCAP00000010759   Gene: ENSFCAG00000011590   Transcript: ENSFCAT00000011593
Sequence length 371
Comment pep:known_by_projection chromosome:Felis_catus_6.2:C1:10640571:10657545:1 gene:ENSFCAG00000011590 transcript:ENSFCAT00000011593 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASKPEKRVASSVFITLAPPRRDEAVAEEVRRAAREARPGRSREPPAPTKAPGAGSAGRP
SLWTPPAKAAAPGPAVPSQLSNGGCSPSPPTLDGEDALPDLDLLPPPPPSPDEEPPAPTG
ASLISDLEQLHLPPPPPPPQSLEERPPLQPRPSPPRPSEELPPPPEEPVGFHEREASTDV
CAFCHKTVSPRELAVEAMKRQYHARCFTCRTCRRQLAGQSFYQKDGRPLCESCYQDTLEK
CGKCGEVVREHIIRALGQAFHPTCFTCVTCARCIGDESFALDNQNEVYCLDDFYRKFAPV
CSICENPIIPRDGKDAFKIECMGRNFHENCYRCEDCRTLLSVEPTDQGCYPLNNRLFCKP
CHVERSAAGCC
Download sequence
Identical sequences M3WFD3
ENSFCAP00000010759 XP_019691800.1.62641

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]