SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSFCAP00000010844 from Felis catus 76_6.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFCAP00000010844
Domain Number 1 Region: 38-145
Classification Level Classification E-value
Superfamily PH domain-like 0.00000000000211
Family Pleckstrin-homology domain (PH domain) 0.014
Further Details:      
 
Domain Number 2 Region: 455-518,570-601
Classification Level Classification E-value
Superfamily Second domain of FERM 0.00000000658
Family Second domain of FERM 0.0099
Further Details:      
 
Weak hits

Sequence:  ENSFCAP00000010844
Domain Number - Region: 348-442
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.00062
Family Ubiquitin-related 0.082
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFCAP00000010844   Gene: ENSFCAG00000011682   Transcript: ENSFCAT00000011685
Sequence length 741
Comment pep:known_by_projection chromosome:Felis_catus_6.2:E1:43188722:43194540:-1 gene:ENSFCAG00000011682 transcript:ENSFCAT00000011685 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QGPLDVTLTQPVRSGPASDRLQSWEETRSLIPEKGPPEEDPDVVVKGWLYREPRGGGARP
WLPPRRAWFVLTRDSLDQFSSSGKGARRLGSLVLTSLCSVTGPERRPKETGLWSVTVSGR
KHSIRLCSPRQAEAERWGVALREVIASKAPLETPTQLLLRDIQESCGDPEAVALIYRRNP
ILRHTSGALYAPLLPLPYGVSAPGPGYAPLREEAVRLFLALQALEGARRPGPLMQGVLQT
CRDLPALRDELFLQLAKQTSGPAGPPGPPATQDPAALRYWQLLTCMSCTFRPGGAVRERM
TGLAKLTEQALPDTELAEYARFIRKALGRTRGRELVPSLAEISALSRRQELLCTVHCPGA
GACPVAIDSHTTAGEVARELVGRLGLARSRNAFALYEQRGAQERALAGSTLVADVLTRFE
NLAAEEAGLDDSTDSGWRLCLRLHGPLHPEGLSPDGHELPFLFEQAHALLLRGRPPPPED
TLRALAALRLQSLHRDFSPREPLPPLDRLLPPPAPPREDPPRPVPRPPPSAALLAGAIWS
PGLAKRRAERTRRGGGAGSTAGSVAREGGGGAGTAAAVLGGWKRLRGMGRAEAMAAYLAL
AAQCPGFGAARYDVLELSTEPGGGTPQKLCLGLGAKAMSLSRPGETEPIHCVSYGHVAAC
QLMGPHTLALRVGESQLLLQSPQVEEIMQLVNAYLPSPSPERPCRSPSPPCQDLPDTSPP
SQHPGLDEPQGQSGCLGQLQD
Download sequence
Identical sequences ENSFCAP00000010844

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]