SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSFCAP00000010847 from Felis catus 76_6.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFCAP00000010847
Domain Number 1 Region: 2-355,385-405
Classification Level Classification E-value
Superfamily Thiolase-like 1.44e-74
Family Thiolase-related 0.0017
Further Details:      
 
Domain Number 2 Region: 2166-2419
Classification Level Classification E-value
Superfamily alpha/beta-Hydrolases 1.09e-55
Family Thioesterase domain of polypeptide, polyketide and fatty acid synthases 0.00000000223
Further Details:      
 
Domain Number 3 Region: 499-619,682-780
Classification Level Classification E-value
Superfamily FabD/lysophospholipase-like 2.35e-39
Family FabD-like 0.005
Further Details:      
 
Domain Number 4 Region: 1849-2019
Classification Level Classification E-value
Superfamily NAD(P)-binding Rossmann-fold domains 2.63e-30
Family Tyrosine-dependent oxidoreductases 0.00048
Further Details:      
 
Domain Number 5 Region: 1663-1765
Classification Level Classification E-value
Superfamily NAD(P)-binding Rossmann-fold domains 0.0000000000000867
Family Alcohol dehydrogenase-like, C-terminal domain 0.0018
Further Details:      
 
Domain Number 6 Region: 1224-1405
Classification Level Classification E-value
Superfamily S-adenosyl-L-methionine-dependent methyltransferases 0.000000000000728
Family UbiE/COQ5-like 0.076
Further Details:      
 
Domain Number 7 Region: 2070-2130
Classification Level Classification E-value
Superfamily ACP-like 0.0000000000864
Family Acyl-carrier protein (ACP) 0.00017
Further Details:      
 
Domain Number 8 Region: 619-675
Classification Level Classification E-value
Superfamily Probable ACP-binding domain of malonyl-CoA ACP transacylase 0.00000000405
Family Probable ACP-binding domain of malonyl-CoA ACP transacylase 0.0074
Further Details:      
 
Domain Number 9 Region: 1558-1645
Classification Level Classification E-value
Superfamily GroES-like 0.0000000471
Family Alcohol dehydrogenase-like, N-terminal domain 0.0074
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFCAP00000010847   Gene: ENSFCAG00000011685   Transcript: ENSFCAT00000011688
Sequence length 2429
Comment pep:known_by_projection chromosome:Felis_catus_6.2:E1:61993031:62010510:-1 gene:ENSFCAG00000011685 transcript:ENSFCAT00000011688 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEEVVIAGMSGKLPESENMEEFWANLIGGVDMVTDDDRRWKAGLYGLPKRTGKLKDLSKF
DASFFGVHPKQAHTMDPQLRLLLEVTYEAILDGGINPATLRGTHTGVWVGVSGSEASEAL
SRDPETLVGYSMVGCQRAMMANRLSFFFDFKGPSIALDTACSSSLLALQNAYQAIRRGEC
PAAIVGGLNLLLKPNTSVQFMKLGMLSPDGICKAFDESGDGYCRAEAVVAVLLTKKSLAR
RVYATILNAGTNTDGCKEQGVTFPSGEVQEQLIRSLYEPAGLSPESLEYIEAHGTGTKVG
DPQELNGIARALCPSRQEPLLIGSTKSNMGHPEPASGLAALAKVLLSLEHGLWAPNLHFR
SPNTKIPALQDGRLQVVQQPLPVRGGNVCINSFGFGGSNVHVILRPNMRPPLAPTRHASL
PRLLRASGRTPEAVHCLLDQGHRHSQDLAFVSMLNDIAAISPTAMPFRGYTVLGGKGGSQ
EVQLVAAGKRPLWFICSGTGMGAQWCGMGLSLMRLGSFRDSILRSDEAVKPLGLQVSELL
LSTDEATFDDIIHAFVSLTAIQIALIDLLNSMGLRPDGIIGHSLGEVACGYADGCLSQEE
AILAAYWRGQCIKETNIPPGTMAAVGLSWEECKQRCPPGVVPACHNSEDTVTISGPQAEV
AAFVAELKREGVFAKEVRTGGMAFHSYFMDSIAPTLLQALKKVIREPRPRSARWLSTSIP
EAQWQGSLARTFSAEYNVNNLVSPVLFQEALWHVPGDAVVLEIAPHALLQAVLKRGLKSS
CTIVPLMKKDQRDNLEFFLSNVGKLHLLGFDVNPNGLLPPVEFPVPRGTPLISPHIKWDH
SQTWDVPTAKDFPSGSSGSSASTVCNISISPESPDHYLADHCIDGRVLFPATGYLCLVWK
TLARTLSQNMEQVPVAFEDVTLHQATVLPKTGTVPLEVRLLQASRTFEVSENGNLIVSGK
VYQWEDPDTKLFDSRDGLDATDPMATFHLSQRDVYKELRLRGYDYGPHFQGILEANLEGN
AGRLLWKNNWVTFLDAMLQTSILGLAQRGLRLPTRITSVRIDPATHQRRVYSLQGEAQAV
NVLVNRCLNSTVAGGVLVSGLHASMAPRRQQEQFAPILEKFCFTPHTEEGLLAGDAALQE
GLQLCRGLAQALQTKVAQQGLKMVVSGLDGAQAPQEPPKQGLPRLLAAACQLQLNGGLQL
ELGQLLAQQRPLLQDDPLLSGLLASPALKACVDTALENMPSLKMKVVEVLAGDGRLYSHI
PALLNTQPMLQLEYTATDRHPQALEAVQAKLQQHGIAQGQWDPADHAPGSLGSADLLLCN
CAVASLGDPAVAVGNMGAALKEGGFLLLHALLKGHPLGETVAFLTCPEPQRGQQSLLSQV
QGLFAGASLHLVALKKSFYGSVLFLCRRPVLWDSPVFLPVEDPSFQWVNSLKNILADSSQ
QPVWLTATSCPDSGVVGLVNCLRREPGGHRIRCVLVSNLSSTSSTPSLDPGSSELQKVLR
GDLVMNVYRDGAWGAFRHFPLERGLPEEQTEHAFVNVLTRGDLSSIRWVCSPLRHTQLTG
PGTHLCAVYYASLNFRDIMLATGKLSPDAIPGKWARHDCLLGMEFSGRDASGKRVMGLVP
AEGLATSVLLSQDFLWEVPSSWTLAPNPRPSPAAWLTGTRLCLPGSAEKRAYLQARFPQL
DDTSFANSRDTSFEQHVLRHTAGKGVDLVLNSLAEEKLQASVRCLAQHGRFLEIGKFDLS
NNHLLGMAVFLKNVTFHGVLLDSLMDEGGNSWQEVAALLKAGIRDGVVQPLKCTVFPKDR
VEDAFRYMAQGKHIGKVVVQVRREEPEAVLRETGPTLMAAVSKTYCPAHKSYVITGGLGG
LGLELAQWLVLRGARKLVLTSRSGIRTGYQAKQVREWRRQGIQVLVSTSNASSLDGAQSL
IDEATQLGPVGGVFNLAVVLRDAMLENQTPELFEDVVRPKYSGTVNLDRVTRAACPELDY
FVAFSSVSCGRGNAGQTNYGFANSTMERVCEKRQHDGLPGEPTLPQRIASCLEVLDVFLN
QPHPVLSSFVLAEKKATAHNDSSSRQDPMEAVAHILGIRDLATVNLDSSLADLGLDSLMG
VEVRQMLEREHDLVMSMRDIRQLTLRKLQELSSKAGTANELAAPTPKEDTPAGQQAQLNL
STLLVNPEGPTLTRLNSVQSSERPLFLVHPIEGSITVFRSLASKLSIPTYGLQCTRAAPL
DSIQSLAAYYIECIRQVQPEGPYRIAGYSYGACVAFEMCSQLQAAQQGPTPAHNSLFLFD
GSHTYVLAYTQSYRAKLTPGCEAEAEAXKSLEERVAATVDLITRSHAGLDPRELSFAARS
FYHKLRAAEQYIPRATYHGNVTLLRTKTGSVYSEGLGADYNLSQVCDGKVSVHVIEGDHR
TLLEGSGLETILSIIHSSLAEPRVSVREG
Download sequence
Identical sequences ENSFCAP00000010847

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]