SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSFCAP00000010876 from Felis catus 76_6.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFCAP00000010876
Domain Number 1 Region: 1071-1153
Classification Level Classification E-value
Superfamily Immunoglobulin 1.81e-20
Family I set domains 0.014
Further Details:      
 
Domain Number 2 Region: 1157-1243
Classification Level Classification E-value
Superfamily Immunoglobulin 1.32e-18
Family I set domains 0.031
Further Details:      
 
Domain Number 3 Region: 764-823
Classification Level Classification E-value
Superfamily BPTI-like 1.91e-18
Family Small Kunitz-type inhibitors & BPTI-like toxins 0.0021
Further Details:      
 
Domain Number 4 Region: 933-1013
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000000596
Family I set domains 0.015
Further Details:      
 
Domain Number 5 Region: 309-367
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000000366
Family TSP-1 type 1 repeat 0.0039
Further Details:      
 
Domain Number 6 Region: 31-80
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000000693
Family TSP-1 type 1 repeat 0.00084
Further Details:      
 
Domain Number 7 Region: 393-453
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000131
Family TSP-1 type 1 repeat 0.003
Further Details:      
 
Domain Number 8 Region: 509-567
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000017
Family TSP-1 type 1 repeat 0.0041
Further Details:      
 
Domain Number 9 Region: 452-509
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000785
Family TSP-1 type 1 repeat 0.0033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFCAP00000010876   Gene: ENSFCAG00000011718   Transcript: ENSFCAT00000011721
Sequence length 1302
Comment pep:known_by_projection chromosome:Felis_catus_6.2:B3:119827947:119859600:1 gene:ENSFCAG00000011718 transcript:ENSFCAT00000011721 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQAEIRMFLLVPLLLAPAPGSSAPKVRRQSDLWGPWGSWGPCSRTCGGGISFRERPCYSQ
RTDGGSSCVGPVRSHRSCHTESCPTGARDFRAEQCAQFDGQDFQGKRYKWLPYYGACSAP
NKCELNCIPKGENFYYKHREAVVDGTPCEPGKRDVCVEGSCRAVGCDHNLDSSKEEDKCL
QCGGDGTTCYPVTGTFDANDLSRGYNQILIIPSGATSIRVEEAAASRNFLAVKSIRGEYY
LNGHWTIGGAWALPVASTVLHYERGAEGDLAPERLLARGPTSEPLVIELLSQEPNPGVSY
EYHLPLGSPRPGFHWSHGSWSDCSTECGGGHQSRPVFCTTDNEVYPDHMCQPQLRPTDHR
PCSTHPCPQTKRTSYLHQPRAWHLAGAQRACRNSWKTGPWSPCSASCGGGSQSRSVYCVL
SDGAGVQEATEEAGCAGLPGKPPTVRPCNLQRCASWSAEPWGECSVSCGAGIRKRSVTCR
GDEGSLLQATACPLEDRPPVSEPCAHEDCPPVSDQAWHVGAWGLCSKSCSSGTRRRQVVC
ALGPPSRCGSLAQSKPGEVEPCNTQPCHLPPGVPSMQDMHSSPGDPRISLGPQAAPTSDS
RGQWWARQEQPSAQGIPTGAQGLHLPAPAPSFQQSPHRQSGLAPHDCRLSPYGCCPDGHT
VSLGPQWQGCPGASCQQSRYGCCPDGVSVAEGPHQAGCAASYSSDKTGRRPVSRAVASTA
PKAHQPQAQQKEPSECQGSRFGCCYDNVASAAGPLGEGCVGQPSYAYPVRCLLPSAHGSC
TDWAARWYFVPSVGQCNRFWYGGCHGNGNNFASEEECVSSCRGRQQEPPRPEPGASGQST
HRDGGGSGPGGQQEAGGHRTGATVQTRPLPSGGLWWRDREPGPGEEGHAQAFGERPLGQE
LGPSAPGLGGDAGRPAAPSHSSSYRISLAGSEPALVQAALGHLVRLFCQDDTSPEPHARW
QKDGRPISSDRHKLQPDGSLVISPLRAEDTGTYSCGSSRPGRDSQKIQLRVTGGDVAVLS
EAEPRHFPQTRDPAQGHSPRESSLVGNAGGLGAVSSLQIRPTTRLLLDRNQPRVVDARPG
QRIRLTCRAEGFPPPAIEWQRDGQPLSSPRHQLQPDGSLVISHVAPEDGGFYACVAFNGQ
DRDQRWVQLRVLGELAITELPSTMLVPEGDTARLLCVVTGESVNIRWSRNGLPVRADGHR
VYQSPDGTLLIHNLQPRDEGSYTCSAYRGSQAVSRSTEVKVGPPALAAQSRDLSRECMDQ
PELANCDLILQAQLCGNEYYSSFCCASCSRFQPHARPVWQQG
Download sequence
Identical sequences ENSFCAP00000010876

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]