SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSFCAP00000010975 from Felis catus 76_6.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFCAP00000010975
Domain Number 1 Region: 268-527
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 8.89e-77
Family Eukaryotic proteases 0.0001
Further Details:      
 
Domain Number 2 Region: 147-252
Classification Level Classification E-value
Superfamily Kringle-like 9.91e-33
Family Kringle modules 0.00021
Further Details:      
 
Domain Number 3 Region: 47-93
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000344
Family EGF-type module 0.01
Further Details:      
 
Domain Number 4 Region: 86-123
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000127
Family EGF-type module 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFCAP00000010975   Gene: ENSFCAG00000011829   Transcript: ENSFCAT00000011832
Sequence length 531
Comment pep:known_by_projection chromosome:Felis_catus_6.2:D2:72591533:72604754:1 gene:ENSFCAG00000011829 transcript:ENSFCAT00000011832 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
CPLPTSVDWTPDYYESSYEYYNHEENSSDTLAYQENPNWYYTEEGILDPCLDHPCKRNGD
CLVSGDTFTCSCPAPFSGHRCQNVQNTCKNKPCGRGECLITQSPPYYRCVCKHPYSGSDC
STAVPACRPNPCQNGGICSRHKRRTKFVCTCPEQFKGKFCEIGPDDCYVGDGYSYRGKVS
KTVNQHSCLYWNSHLLLHENYNMFMEDADTHGIGEHNFCRNPDGDEKPWCFIKVNNAKVK
WEYCDIPACSALDIADPEGSPTEPLSKLPGFDSCGKTEMGKVKRIYGGFKSTAGKHPWQA
SLQTSLPLTASMPQGHFCGGSLIHPCWVLTAAHCTDIKTKHLKVVLGDQDLKKTEFHEQR
FGVEKIFKYSHYNERDEIPHNDIALLKLKPVDGHCALESKYVKTVCLPDGAFPSGTECHI
SGWGVTETGEGSRQLLDAKVKLIASTLCNSHRLYDHMIDNSMICAGNLQKPGKDSCQGDS
GGPLTCEKNGTYYVYGIVSWGLECGKKPGVYTLVTKFLNWIKATIQRETSF
Download sequence
Identical sequences ENSFCAP00000010975

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]