SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSFCAP00000010976 from Felis catus 76_6.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFCAP00000010976
Domain Number 1 Region: 4-31
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.00000169
Family LASP-1 0.016
Further Details:      
 
Weak hits

Sequence:  ENSFCAP00000010976
Domain Number - Region: 32-56
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.0402
Family LIM domain 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFCAP00000010976   Gene: ENSFCAG00000011830   Transcript: ENSFCAT00000011833
Sequence length 1735
Comment pep:known_by_projection chromosome:Felis_catus_6.2:D2:72605364:72675835:-1 gene:ENSFCAG00000011830 transcript:ENSFCAT00000011833 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNVQACSRCGYGVYPAEKISCLDQIWHKACFHCEVCKMMLSVNNFVSHQKKPYCHAHNPK
NNTFTSVYHTPLNLNMRKTPEAIHGVDDQDDSERFKSVFHWDMKSRDGADAANRQPLVNE
RGSWTGYGEGSGWCPGSLPDPEIVRMVEARKSLGEQEYTEDYEQQRGKGSFPAMITPAYQ
RAKKANQLASQVEYKRGHDERISTFSTVADTPELLRAKAGGQLQSDVRYAEDYEQQRGKG
SFPAMITPAYQIAKRANELASDVRYHQQYQREMKGVASPAAGAAGASSRECMDQYGQGYL
EEYEEHRGKGSFPAMITPAYQNAKKANELASDIKYRQDFNKMKGPAHYHSLPAQDNLVLK
RAQSVNKLVSEVEYKKDLESSKGHSINYCETPQFRNVSKISKFTSDNKYKENYQNHMRGH
YEGVGMDRRTLHAMKVGSLASNVAYKADYKHDVVDYNYPATLTPSYQTTVRLVPLKDVNY
RQSIDKLKYSSVTNTPQIVQAKINAQQLSHVNYRADYEKNKLNYTLPQDIPQLVKARTNA
ELFSEVKYREGWDKAKGKGFELKLDAMSLLAAKASGELASNIKYKEEYEKSKGKVMGTTD
SRLLHSLQVAKMSSEVEYKKGFEESKTRFHLPMDMVHIKHAKKAQALASDLDYRKKLHEY
TVLPEDMKTQWAKKAYGLQSELQYKADLAWMKGVGWLTEGSLNLEQAKKAGQLISEKQKN
YRQRADELKFTSVTDSSQMAHARKSQELQSGVAYKAGNEQSVHQYSISKDEPLFLQARAN
AANLSEKLYKSSWENQKAKGFELRRHESCRFPSRRVRKVAAARVVKYKEDYERSRGKLIG
AKDAQGDSQMSHSLQMSKLQSDLEYKKGFEDTRAQCHVSLDMVHLVHARKAQHLATDIGY
KTASHHFTALPTDMRVEWAKKAYGLQSDNQYRADVKWMKGTGWVATGSLNVEQAKKAGEL
ISEKKYRQPPDALKFTSIKDTPEMVQARISYTQAVDRLYKEQGENIKHHYTQTADLPEVL
LAKLNAMNISETRYKESWSKLRDGGYKLRLDAIPFQAAKASGEIISDYKYKEAFEKMKGQ
MLGSRSLEDDISLAHSVYANSLQSEVNYKKGFELSKAHFHLPLDMVTLVHARKAQSLASD
QDYRHPLPQYTSLAEDLRLSCAKRAHKLQSENLYRSDLNFMRGVPCVIPGTLEIEGRKKA
SELISESKYRQHPQSFKYTAVTDTPSLLHAKLSNQITNERLYKAAGDEERHRYTMTLGLP
EFARAKANAANLSDAKYKESWRNLRAQGYKLTIDALPFQAARVSGDIASDFLYRHDFVKE
RGRLIGTRSVSEDPRLRHCWRVGQLQSELQYRRGAAGSRAQCHLPMDMVHLVHARKAQAL
ASDHDYRTWCHEFTALPEDLKMSWAKRAHALQSEFRYKSDLMGMKGTGWLTLSSPQLECA
KKAGELISETKYRKKPDSIKFTTVVDSPDLVHAKNSYLHCNERLYRAGDAESLHRYTPIP
DHPDFTRARLNAQCLSDKAYRNSWEQTRAVGYDFRLDAIPFQTARASREIASDFRYKEAF
LRDRGQQIGYRSVQDDPRMRHFLNVGRLQSDNEYKKDFAKSRSQFHSRPDQPGLLQARRS
QQLASDVCYRQPLPQPTCDPEQLGLKHAQKAHQLQSDVKYKSDLNLTRGIGWTPPGSYKV
EMARRAAELAKARGLGLRGADGGPEAVEPADNQRGDVNPDAMEILHVKRRRGLPL
Download sequence
Identical sequences ENSFCAP00000010976

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]