SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSFCAP00000011220 from Felis catus 76_6.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFCAP00000011220
Domain Number 1 Region: 60-189
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000256
Family Spectrin repeat 0.018
Further Details:      
 
Domain Number 2 Region: 214-329
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000301
Family Spectrin repeat 0.0056
Further Details:      
 
Domain Number 3 Region: 601-742
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000000878
Family Spectrin repeat 0.0088
Further Details:      
 
Domain Number 4 Region: 502-609
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000106
Family Spectrin repeat 0.015
Further Details:      
 
Weak hits

Sequence:  ENSFCAP00000011220
Domain Number - Region: 425-506
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0132
Family Spectrin repeat 0.0074
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFCAP00000011220   Gene: ENSFCAG00000012093   Transcript: ENSFCAT00000012096
Sequence length 974
Comment pep:known_by_projection chromosome:Felis_catus_6.2:B3:139412074:139466468:-1 gene:ENSFCAG00000012093 transcript:ENSFCAT00000012096 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTQPPQEGFDRSVEEARQWMKAVQERLQVNDNTQGPRAALEARLRETEKICQLEPEGRVK
VDVVLRAAEGLLACCRGGQKPEILAQLKDIKAQWEETVTYMTHCHSRIEWVWLHWSEYLL
ARDEFYRWFQKMMVVLELPVELQLGLKEKQWQLSHAQVLLHNVGNQAVLLDRLLEEAASL
FNRIGDPSVDEDAQKRMKAEYAAVKAKAQDRVDLLEQVTREHEHFQAGVDEFQLWLKAVV
EKVSSCLGRNCKLTTEGRLCALQDIAGDFPRGKESLRRLEEQAVGVIQNTSPLGAEKITE
ELEEMQKVLDKLRALWEEEEERLQGLLKSMGACEQQRRQLEAELGEFRKDLQRLAEEGLE
PAAKAGTEDELVDRWRLYSATRAALAAEEPRATRLQAQLKELIVYPHDLQPLSDSVVAAL
QEYQSMKGQSARLRNATGAELWQRFQRPLQDLQLWTALAQSLLDITASLPDLPSIHTFLP
QVEAALAESSRLKEQLMMLQLKKDLLRSVFGQDKATALLEQVASSVRDRDLLHNGLLQRK
SKLQSLLAQHQDFGAAFEPLRKKLSDLQGRVRAENGLQQDLPRKQTQLSRLQGLQEEGLD
LGAQMEAVRPLVQGNPTHQHKMEQLSADYQALQRSLEDLMDRCQQSVREHCTFSHQLLEL
RQWIAVVTQKLESHQEEAGPWDAQSREVEVERLLAEFPEKEAQLPLVEAYGRLVMKKSSP
EGAALVQEELEELVQSWQALKLLEEGLLSLIRNQQLQRTEVDSGKKTIFTNNIPKTGFLI
DPAEPLSGRHRRANLLREEGSREGYSQLLRDFEQWLEVENAKLVSIIAMRMAAARDLRAR
ETKLQELQARVPEGQRLFENLLHVGPARGSSDELEDLRYRWMLYKSKLKDSSHLLTQSSP
GEPTGFQKAPRWRGLGPLFRKVCCVALPLQLLFLLFLLLLFLLPVGEENRSCTLANNFAR
SFKFMLRYDGPPPT
Download sequence
Identical sequences A0A2I2U9M3
XP_003988000.1.62641 XP_006933142.1.62641 XP_019689158.1.62641 XP_019689159.1.62641 XP_019689160.1.62641 ENSFCAP00000011220

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]