SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSFCAP00000011249 from Felis catus 76_6.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFCAP00000011249
Domain Number 1 Region: 64-183,259-363
Classification Level Classification E-value
Superfamily FabD/lysophospholipase-like 1.1e-63
Family FabD-like 0.0000601
Further Details:      
 
Domain Number 2 Region: 192-266
Classification Level Classification E-value
Superfamily Probable ACP-binding domain of malonyl-CoA ACP transacylase 0.000000929
Family Probable ACP-binding domain of malonyl-CoA ACP transacylase 0.0056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFCAP00000011249   Gene: ENSFCAG00000012127   Transcript: ENSFCAT00000012129
Sequence length 383
Comment pep:known_by_projection chromosome:Felis_catus_6.2:B4:138187432:138195364:-1 gene:ENSFCAG00000012127 transcript:ENSFCAT00000012129 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSVRVARVAWARDWGAGCSRGVSNFPLPPSGAVNVAELLRDATAAEEGPREAAARRRPPG
QCSVLLFPGQGSQVVGMGRGLLGYPRVRELYAAARSVLGYDLLELSLHGPQEALDRTVHC
QPAVFVASLAAVEKLHHLQPAVIENCVAAAGFSVGEFAALVFAGAMEFSEGLRAVKIRAE
AMQEASEAVPSGMLSVLGQPQSKFTFACLEAREHCKTLGIENPVCEVASYLFPDCRVISG
HLEALRFLRKNSSKYHFRRTKMLPVSGGFHTRLMEPALEPLAQVLKSVAVKEPLVAVHSN
VDGNRYRHPKHIRKLLAQQVVSPVKWEQTMHAVYGRRKGTGFPETFEVGPGKQLGSILKS
CNLQAWRSYGHVEVLEDPEDDGT
Download sequence
Identical sequences M3WGD5
ENSFCAP00000011249 XP_003989429.1.62641

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]