SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSFCAP00000011276 from Felis catus 76_6.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFCAP00000011276
Domain Number 1 Region: 312-464
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.46e-34
Family SPRY domain 0.0014
Further Details:      
 
Domain Number 2 Region: 150-262
Classification Level Classification E-value
Superfamily Fibronectin type III 2.25e-16
Family Fibronectin type III 0.0018
Further Details:      
 
Weak hits

Sequence:  ENSFCAP00000011276
Domain Number - Region: 3-110
Classification Level Classification E-value
Superfamily Formin homology 2 domain (FH2 domain) 0.00183
Family Formin homology 2 domain (FH2 domain) 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFCAP00000011276   Gene: ENSFCAG00000012153   Transcript: ENSFCAT00000012156
Sequence length 495
Comment pep:known_by_projection chromosome:Felis_catus_6.2:D4:68957921:69017035:1 gene:ENSFCAG00000012153 transcript:ENSFCAT00000012156 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
EALQRIISTLANKNDEIQNFIDTLNQTLKGVQENSSNILSELDEEFDSLYSILDEVKESM
INSIKQEQARKSQELQSQLSQCNNALENSEELLEFATRSLDLKEPEEFSKAARQIKDRVT
MASAFRLSLKPKVSDNMTHLMVDFSQERQMLQTLKFLPVPKAPEIDPVECLVADNSVTVA
WRMPEEDNKIDHFILEYRKTNFDGLPRVKDERCWETVDNIKGTEYTLSGLKFDSKYMNFR
VRACNKAVAGEYSDPVTLETKALNFNLDSSSSHLNLRVEDTCVEWDPTGGKGQESKMKGK
ENKGRSGTPSPKRTSIGSRPPAGRGSRDRFTGESYTVLGDTAIESGQHYWEVKAQKDCKS
YSVGVAYKTLGKFDQLGKTNTSWCIHVNNWLQNTFAAKHNNKVKALDVTVPERIGVFCDF
DGGQLSFYDASSKQLLYSFKTKFTQPVLPGFMVWCGGLSLNTGMQVPSAVRTLQKSENGM
TGSASSLNNITQFNL
Download sequence
Identical sequences ENSFCAP00000011276

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]