SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSFCAP00000011534 from Felis catus 76_6.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFCAP00000011534
Domain Number 1 Region: 15-251
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 2.66e-79
Family Calponin-homology domain, CH-domain 0.000000432
Further Details:      
 
Domain Number 2 Region: 2840-2964
Classification Level Classification E-value
Superfamily EF-hand 2.1e-49
Family EF-hand modules in multidomain proteins 0.00000599
Further Details:      
 
Domain Number 3 Region: 2966-3061
Classification Level Classification E-value
Superfamily EF-hand 2.27e-38
Family EF-hand modules in multidomain proteins 0.0000149
Further Details:      
 
Domain Number 4 Region: 1922-2078
Classification Level Classification E-value
Superfamily Spectrin repeat 1.08e-26
Family Spectrin repeat 0.0013
Further Details:      
 
Domain Number 5 Region: 3041-3129
Classification Level Classification E-value
Superfamily RING/U-box 5.65e-21
Family ZZ domain 0.0092
Further Details:      
 
Domain Number 6 Region: 314-418
Classification Level Classification E-value
Superfamily Spectrin repeat 4.84e-19
Family Spectrin repeat 0.0032
Further Details:      
 
Domain Number 7 Region: 2503-2634
Classification Level Classification E-value
Superfamily Spectrin repeat 8.16e-19
Family Spectrin repeat 0.011
Further Details:      
 
Domain Number 8 Region: 386-526
Classification Level Classification E-value
Superfamily Spectrin repeat 3.27e-17
Family Spectrin repeat 0.0036
Further Details:      
 
Domain Number 9 Region: 493-631
Classification Level Classification E-value
Superfamily Spectrin repeat 9.64e-17
Family Spectrin repeat 0.0044
Further Details:      
 
Domain Number 10 Region: 963-1107
Classification Level Classification E-value
Superfamily Spectrin repeat 3.89e-16
Family Spectrin repeat 0.0097
Further Details:      
 
Domain Number 11 Region: 2680-2799
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000000353
Family Spectrin repeat 0.007
Further Details:      
 
Domain Number 12 Region: 2232-2332
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000000732
Family Spectrin repeat 0.0049
Further Details:      
 
Domain Number 13 Region: 743-901
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000000864
Family Spectrin repeat 0.0027
Further Details:      
 
Domain Number 14 Region: 1181-1332
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000158
Family Spectrin repeat 0.0035
Further Details:      
 
Domain Number 15 Region: 1491-1646
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000288
Family Spectrin repeat 0.0062
Further Details:      
 
Domain Number 16 Region: 2392-2516
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000129
Family Spectrin repeat 0.0036
Further Details:      
 
Domain Number 17 Region: 2802-2839
Classification Level Classification E-value
Superfamily WW domain 0.0000000000905
Family WW domain 0.00023
Further Details:      
 
Domain Number 18 Region: 2073-2177
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000249
Family Spectrin repeat 0.0041
Further Details:      
 
Domain Number 19 Region: 1619-1744
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000272
Family Spectrin repeat 0.011
Further Details:      
 
Weak hits

Sequence:  ENSFCAP00000011534
Domain Number - Region: 1305-1434
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000272
Family Spectrin repeat 0.0079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFCAP00000011534   Gene: ENSFCAG00000012433   Transcript: ENSFCAT00000012436
Sequence length 3427
Comment pep:known_by_projection chromosome:Felis_catus_6.2:B2:132120689:132622941:1 gene:ENSFCAG00000012433 transcript:ENSFCAT00000012436 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAKYGEHEARPDDGQNEFSDIIKSRSDEHNDVQKKTFTKWINARFSKSGKPPINDMFTDL
KDGRKLLDLLEGLTGTSLPKERGSTRVHALNNVNRVLQVLHQNNVDLVNIGGTDIVDGNH
KLTLGLLWSIILHWQVKDVMKDVMSDLQQTNSEKILLSWVRQSTRPYSQVNVLNFTTSWT
DGLAFNAVLHRHKPDLFNWDRVVKMSPIERLEHAFSKAQTYLGIEKLLDPEDVAVQLPDK
KSIIMYLTSLFEVLPQQVTIDAIREVETLPRKYKKECEEGEISIRSSAPEEEHESPRAET
PSTVTEVDMGLDSYQIALEEVLTWLLSAEDTFQEQDDISDDVEEVKRQFATHEDFMMELT
AHQSSVGNVLQAGNQLITQGTLSDEEEYEIQEQMGLLNARWEALRVDSMDRQSRLHDVLM
ELQKKQLQQLSAWLTLTEERIQKMETCPLDDDLKSLQKLLEDHKRLQNDLEAEQVKVNSL
THMVVIVDENSGESATAVLEDQLQKLGERWTAVCRWTEERWNRLQEINILWQELLEEQCL
LKAWLTEKEEALNKVQTSNFKDQKELSVSIRRLAILKEDMEMKRQALDQLSEIGQDVSQL
LDNPKASKKINSDSEELTQRWDSLVQRLEDSSNQVTQAVAKLGMSQIPQKDLLETVRVRE
QVTTKRSKQELPPPPPPKKRQIPVDLEAKKKFDAVSAELLSCILKSKTAIQAAEIKGYKK
MQETSEVKKKLKALEKEQTERSPRLNELNQTGQILLEQMGKEGIPTEEIKNVLEKVFSEW
KDVSQHLEDLARKIQLQEDINAYFKQLDDLEKTVKTKEEWVKHTPFSESPQQSLQSLKDS
CQRELTDLLSLHPKIEKVRAGCSALKSQRSTPDFVQQGFDTFLGHYHAVQQELEHRQQQL
ENELKSQPGHAYLETLKTLKDILNDSESKAQTSLNVLNDLTKVEKTLQEKKALDEILENQ
KPTLYKLAEETKALEKNVSPDVKTMYKQEFDDVQGKWNKLKVKVSKDLHLLEEITPKLGA
FEADLKVIEKWMDGVKDFLMKEQAVQGDAEGLQRELDQCSAFVNEIETIESSLKDMKEIE
ADLRSYPVAGIKTWIQTKLVDCQTQVEKFSKEIAIQKTRLSESQEKAVNLKKDLAEMQEW
MAQAEEEYLERDFEYKSPEELGSAVEEMKRAKEDVLQKEVRVKILKDNIKLLAAKVPSGG
QELTSELKVVLENYQLLCNRIRGKCHTLEVCSVMFLRSNYLDLETTWLSTLEERMKSTEA
LPEKTDAVNEALESLESVLRHPADNRTQIRELGQTLIDGGILDDIISEKLEAFNSRYEEL
SHLAESKQISLEKQLQVLRETDHMLQVLQESLGELDQQLTTYLTDRIDAFQVPQEAQKIQ
AEISAHELTLEELRKNARSQPPTSPEGRNARGGSQMDVLQRKLREVSTKFQLFQKPANFE
QRMLDCKRILDCVKAELHVLDVKDVDPDVIQNHLDKCMKLYKTLSEVKLEVETVIKTGRH
IVQKQQTDNPKGMDEQLTSLKILYNDLGAQVTEGKQELERASQLARKMKKEAASLSEWLS
VTEAELVQKSTSESLLGDLDIEISWAKNILKDLEKRKADLNAITESSTALQNLIEGSEPV
LEERLCVLRAGWSRVRTWTEDWCSTLMNHQNQLEIFDGNVAHISTWLYQAEALLDEIEKK
PASKREEIVKRLISELDDASLQVENVRDQAVVLMNTRGGASRELVEPKLAELNRNFEKVS
QHIKSAKLLIGQEPLSYQCLVTTEAHETDVLFADLEKLEIDIENMLKVVEKHLEFSEEDE
KMDEERAQVEEVLQRGEQMLHEPMEENKKEKIRLQLLLLRTKYNKTKVLSWESLCSTLAP
GIRLPPPPTDYLVEINKILLSMDDTELLLNAPELNTVVYEDFSFQEDSLKNIKDQLDKLG
EQIAIIHEKQPDVILEASGPEAIQIRDTLTQLNAKWDRINRMYNDRKGYFDRAMEEWRQF
HCDLNDLTQWLTEAEELLAETFAPDGGLDLEKARMHQQELEEGISSHQPSFAALNRTGDG
IVQKLSPTDGSFLKDKLAGLNQRWSVIFVEVKDRRPRLKGVSKQVMEYRKRLDDIICWLS
KTESAVQKRSTTELEENLQELTDLTREMDVQAEKLKWLNRTELEVLSDKSLSLHERQKIS
ESLRTVNSTWNKICREVPTTLKERIQEPSSVSQTRMAAHPNVQKVVLESSASDIPVLSPR
TSEISIPADLDKTITELADWLVLIDQMLKSNIVTVGDVEEINKTVSRMKITKADLEQRHP
QLDCVFTLAQNLNKASSSDVRTAITEKLEKVKNQWDSTQHGVELRQQQLEDMIIDSLQWD
DHREETEELMRKYEARLYILQQARRDPLIKQISDNQILLQELDPGDGIVMAFDNVLQKLL
EEYGSDDTRNVKETTEYLKTSWINLKQSVGERQSALEAELRTVQASRRDLENFLKWIQEA
ETTVNVLADASQRENALQDSGLARELAQQMQDIQAEIDAHNDIFKSIDGNRQKMVKALGN
SEEATMLQHRLDDMNQRWNDLKAKSASIRAHLEASAEKWNRLLTSLEELIKWLNIKDEEL
QKQMPIGGDVPALQLQYDHCKALRRELKEKEYSVLNAIDQARVFLADQPIEAPEEPRRNL
QSKTELTPEERAQKIAKAMRKQSSEVKEKWESLNAVTSNWQKQVDKALEKLRDLQGAMDD
LDVDMKEVEAVRNGWKPVGDLLIDSLQDHIEKTMAFREEIAPINLKVQTVNDLSSQLSPL
DLHPSLKMSRQLDDLNMRWKLLQVSVDDRLKQLQEAHRDFGPSSQHFLSTSVQLPWQRSI
SHNKVPYYINHQTQTTCWDHPKMTELFQSLADLNNVRFSAYRTAIKIRRLQKALCLDLLE
LNTTNEVFKQHKLNQNDQLLSVPDVINCLTTTYDGLEQMHKDLVNVPLCVDMCLNWLLNV
YDTGRTGKIRVQSLKIGLMSLSKGLLEEKYRYLFKEVAGPTEMCDQRQLGLLLHDAIQIP
RQLGEVAAFGGSNIEPSVRSCFQQNNNKPEISVKEFIDWMRLEPQSMVWLPVLHRVAAAE
TAKHQAKCNICKECPIVGFRYRSLKHFNYDVCQSCFFSGRTAKGHKLHYPMVEYCIPTTS
GEDVRDFTKVLKNKFRSKKYFAKHPRLGYLPVQTVLEGDNLETPVTLISMWPEHYDPSQS
PQLFHDDTHSRIEQYATRLAQMERTNGSFLTDSSSTTGSVEDEHALIQQYCQTLGGESPV
SQPQSPAQILKSVEREERGELERIIADLEEEQRNLQVEYEQLKEQHLRRGLPVGSPPDSV
VSPHHTSEDSELIAEAKLLRQHKGRLEARMQILEDHNKQLESQLHRLRQLLEQPESDSRI
NGVSSWPSPQQAALTYSLDPDPGPQFHQAAAEDLLAPPHDTSTDLTEFMEQINSTFPSCC
REYERPQ
Download sequence
Identical sequences ENSFCAP00000011534

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]