SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSFCAP00000011727 from Felis catus 76_6.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFCAP00000011727
Domain Number 1 Region: 392-649
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 4.9e-76
Family Eukaryotic proteases 0.00011
Further Details:      
 
Domain Number 2 Region: 260-376
Classification Level Classification E-value
Superfamily Kringle-like 2.3e-23
Family Kringle modules 0.00087
Further Details:      
 
Domain Number 3 Region: 96-144
Classification Level Classification E-value
Superfamily Kringle-like 2.23e-17
Family Fibronectin type II module 0.0021
Further Details:      
 
Domain Number 4 Region: 156-196
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000767
Family EGF-type module 0.0053
Further Details:      
 
Weak hits

Sequence:  ENSFCAP00000011727
Domain Number - Region: 194-233
Classification Level Classification E-value
Superfamily FnI-like domain 0.000209
Family Fibronectin type I module 0.0031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFCAP00000011727   Gene: ENSFCAG00000012646   Transcript: ENSFCAT00000012650
Sequence length 658
Comment pep:known_by_projection chromosome:Felis_catus_6.2:B1:201119957:201128048:1 gene:ENSFCAG00000012646 transcript:ENSFCAT00000012650 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TGRWAWVPSLCPLPGMALLLLLLLVPCGAQPQAGRNLTEPPEPNATVTPGTPTNPVTSVT
PVTLATSAPETQGPHGRGLSPPPRAPSSSSPGSPVLTEDGQPCSFPFRYGGRMLHTCTSE
GSAHRKWCATTHNYDRDRAWGYCAQASAPREGPAALDPCASGPCLNGGSCSNTQDPESYH
CTCPMAFTGKNCGTERCFDETRYEHLEAGDRWARVSQGRVEQCECAGGQIRCEGTRHTAC
LSSPCLNGGTCHLIVATGTTVCACPPGHAGRLCNIVPSQHCFEGSGAEYRGVAGTAASGL
SCLAWNSDLLYQELHVDSVGAAALLGLGPHAYCRSALACPIPHHLMRXPWCYVVKDSALS
WEYCRLDACESLTRINPLPAEVLRSQPEPASAGHQTCGQRHKKRSFLRPRIIGGSSSLPG
SHPWLAAIYIGNDFCAGSLVHTCWVVSAAHCFSNSPRRESVLVVLGQHFFNQTTDVTQTF
GIEKYIPYPMYSVFNPSDHDLVLIRLKKKGDRCAVRSQFVQPICLPEPSSPFPVGHKCQI
AGWGHQDENVSGYSSSLREALVPLVADHKCSSPEVYGADISPHMLCAGYFDCKSDACQGD
SGGPLACEKNGLAYLYGIISWGDGCGRLNKPGVYTRVAKYVDWINDRIRPPKRPADPS
Download sequence
Identical sequences ENSFCAP00000011727

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]