SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSFCAP00000011809 from Felis catus 76_6.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFCAP00000011809
Domain Number 1 Region: 191-270
Classification Level Classification E-value
Superfamily HMG-box 6.94e-23
Family HMG-box 0.00051
Further Details:      
 
Weak hits

Sequence:  ENSFCAP00000011809
Domain Number - Region: 1232-1358
Classification Level Classification E-value
Superfamily Formin homology 2 domain (FH2 domain) 0.0392
Family Formin homology 2 domain (FH2 domain) 0.13
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFCAP00000011809   Gene: ENSFCAG00000012737   Transcript: ENSFCAT00000012740
Sequence length 1611
Comment pep:known_by_projection chromosome:Felis_catus_6.2:E2:12698164:12709108:1 gene:ENSFCAG00000012737 transcript:ENSFCAT00000012740 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MYSAHRPLVPASGAASRGLGMFVWTNVEPRSVAVFPWHSLVPFLAPSQPDPSVQPSEAQQ
PASHPVASNQSKEPAESAAVAHEQPPGGTGNADPGRPPGATCPESPGPGPPHTLGVVEPG
KGPPPTTEEEAPGPPGEPRLDSETESDHDDAFLSIMSPEIQLPLPPGKRRTQSLSALPKE
RDSSSEKDGRSPNKREKDHIRRPMNAFMIFSKRHRALVHQRHPNQDNRTVSKILGEWWYA
LGPKEKQKYHDLAFQVKEAHFKAHPDWKWCNKDRKKSSSEAKPTSLGLAGGHKETRERSM
SETGTAAAPGVSSELLSVAAQTLLSSDTKAPGSGSCGAERLHTVGGPGSARPRAFSHSGV
HSLDGGEVDSQALQELTQMVSGPASYSGTKPSTQYGTPGPFSASGEGGALAASGRPSLLP
TRASRSQRAASEDMTSDEERMVICEEEGDDDVIADDGFGTTDIDLKCKERVTDSESGDSS
GEDPEGSKGFGRKVFSPVIRSSFTHCRPSLDPEPPGPPDPPAAFGKGYGPTPSSSSSSPA
SSSASAATSFPLGSGTFKAQESGQGSTAGPLRPPLPGAGGPVTPSKATRFLSTDPATFRR
KRPESVGGLEPPGPSVIAAPPGGGGSVLQTLVLPPNKEEREGSGARMPSAPAPSLAYGAP
AAPLSRPAATMVTNVVRPVSSTPVPIASKPFPTSGRAEASPSDTAGARTEPVAGSRAPGS
SPLGVSLVYSDKKSAAATSPAPHLVAGPLLGTVGKAPATVTNLLVGTPGYGAPAPPAVQF
IAQGAPGSGAATGSGAGAGSGPNGPVPLGILQPGALGKAGGITQVQYILPTLPQQLQVAP
APAPAPGTKAAAPGGPAPTTSIRFTLPPGTSTNGKVLAATAPTPGIPILQSVPSAPPPKA
QSVSPVQAPPPGGSAQLLPGKVLVPLAAPSMSVRGGGAGQPLPLVSPPFSVPVQNGAQPP
SKIIQLTPVPVSTPSGLVPPLSPATLSGPTSQPQKVLLPSSTRITYVQSAGGHALPLGTS
PTSSQAGTVTSYGPTSSVALGFTSLGPSGPAFVQPLLSAGQAPLLAPGQVGVSPVPSPQL
PPTCTAPGGPVITAFYPGSPAPTSSAPLAQPSQAPPGLVYTVATSTTPPAATILPKGPPA
PATATPAPTSPFPNATAGSMTYSLVAPKAQRPTPKAPQKVKAAIASIPVGSFEAGAPGRS
GPASRQPLEPGPAREPPVPESELEGQPTTPAPPPPPETWAPTARSSPPPPPPAEERTGTK
GPETMASKFPSSSSDWRVPGLGLESRGEPPTPPSPAPAPAPAPSSSSSSSEGSSGRAAGD
TPERKEAAGTGKKVKVRPPPLKKTFDSVDNRVLSEVDFEERFAELPEFRPEEVLPSPTLQ
SLATSPRAILGSYRKKRKNSTDLDSAPEDPTSPKRKMRRRSSCSSEPNTPKSAKCEGDIF
TFDRTGTEAEDVLGELEYEKVPYSSLRRTLDQRRALVMQLFQDHGFFPSAQATAAFQARY
ADIFPSKVCLQLKIREVRQKIMQAATPTEQPPGAEAPLPGPPPTGTAAAPVPTPSPAGGP
DPTSPGSDSGTASAAPPLPPPPEPGPGQPGWEGPPQPSPPPPGPSTAATGR
Download sequence
Identical sequences ENSFCAP00000011809

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]