SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSFCAP00000011873 from Felis catus 76_6.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFCAP00000011873
Domain Number 1 Region: 335-499
Classification Level Classification E-value
Superfamily PH domain-like 1.15e-33
Family Pleckstrin-homology domain (PH domain) 0.0014
Further Details:      
 
Domain Number 2 Region: 1-74
Classification Level Classification E-value
Superfamily SAM/Pointed domain 0.0000000000000077
Family SAM (sterile alpha motif) domain 0.0000694
Further Details:      
 
Domain Number 3 Region: 176-283
Classification Level Classification E-value
Superfamily PDZ domain-like 0.0000000000162
Family PDZ domain 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFCAP00000011873   Gene: ENSFCAG00000012803   Transcript: ENSFCAT00000012807
Sequence length 717
Comment pep:known_by_projection chromosome:Felis_catus_6.2:C1:18778393:18788029:1 gene:ENSFCAG00000012803 transcript:ENSFCAT00000012807 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEPVATWTPAKVAAWLRGLDDSLQDYCFEDWELPGKYLLQLCPQSLEALTVWPLGHQELI
LEGVEQLRALSSGRQTENLQGLTEGLLEVTQAFQSLVGGHLEGCAEPPADVLSAAVELVH
EARALLFWLNRYLFSRLNDFSACQKIGELCAELGQALQEDSPAAEKESKVLSICSHVVEI
CHAILSCSPQELLEQTAVLERVQLDGPLGLEIHTTSNCLHFVSRVGTQVPADSRLQILPG
DEIVQVNEQVVVGWPHKNVVRELLREPAGVSLVLKKVPVPKTPHTVPQTPPRALGSPQLT
ISSLALTPQSPRAPPEDVFAFDLTSNPSPGPSAAWTDSTSLDPESLPIFPAPPATLPAGV
AMTREPQEHPDKSPVPRQKKSKGVATRLSRRRVSCRELGQPDCDGWLLLRKAAGGFMGPR
WRRCWFVLKRHTLYWYRQPQDEKAEGLINVSNYSLESGQDQKKKYVFQLTHDVYKPFIFA
ADTLEDLSMWVRHLITCISKYQSPGRASLPREEDCYSETEAEDPDDEAGSRSGSPSQARA
WSPLHGDTLPAATPMQGGPRTSFGPPTDNSEGALEGMVWGLRQGGVSLLGQPQPLTHEQW
RSSFMRRNQDPQLNERVHRVRALQSTLKAKLQELQALEEVLGDPELTGEKFRRWKERNQE
LYSESLGAWGLVQAEGHSQVLISDSREQSSHPLPSEREEQSHLCPLTPESNRGPPDL
Download sequence
Identical sequences ENSFCAP00000011873

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]