SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSFCAP00000011938 from Felis catus 76_6.2

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSFCAP00000011938
Domain Number - Region: 1282-1287
Classification Level Classification E-value
Superfamily Formin homology 2 domain (FH2 domain) 0.00497
Family Formin homology 2 domain (FH2 domain) 0.13
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFCAP00000011938   Gene: ENSFCAG00000012875   Transcript: ENSFCAT00000012879
Sequence length 1750
Comment pep:known_by_projection chromosome:Felis_catus_6.2:B1:143240641:143305711:-1 gene:ENSFCAG00000012875 transcript:ENSFCAT00000012879 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RDACADPGPAGTGTSDSLSPEPLTSDPQHRKAAWSGGVKLRPKHRRSDPAGRPHSWHLTK
LGENQPEGSMMQITPGTIGSPWPQRYHSSSSTSDLSSYDHAYLRRSPDHCSSQGSMESLE
PSGGYPPCHLLSPAKSTSSIDQLSHLHNKRDSAYSSFSTSSSILEYPPPGISSRERSGSV
DTTSARGGLLEGMRQADIRYVKTVYDPRRGVSAEYEVNSSALLLQGREARASADGQGYDK
WHSVPRGKGAPSPSWSQQCPSSSETATSNLAPKAAAPLPPARSDSYAAFRQRERPNSWSS
LDQKRFCRPQANVAASLKSPFIEEQLHTVLEKSPENSPPAKPKHSYPQKAQPGQPLLPTG
IYPVPSLEPHFAQVPQPSVSGNGTLYPALAKESGYTAPHGACDKMATFDENGNQNGSSRP
GFAFYQPLEPDSMSLVERKPETSAKCVPYRVHFPSVPENEEDTSLERQLAPLHGSSPHPN
ERKSTHSNKPYSNHHSLKVGEDKRSSRPSEPWEGDLHADHNANLQHRLERESLQSPPNNF
GRTKSAFSSLQNIPENLRRQSSVEPGRGAQDGYQDGRSTCVVNSKGEDSGRKAVPDHRSH
LDRPVSYPRPEARTSALASFPSSDPRYEDPPSPPHQQTSSLGRRRLSSSSASALQGFQYG
KPHCSVLEKVSKIEQREQGSQRPLSVGSSHYGHNYRPNRTVPNSHPFGKDFEETKSNIRF
SDPTEPIGNGEQQHFKKEEPKLEEVTRQPHGQQLRRGADGGRGPQLQGSEPPRRDTHLLR
SQSTFQLFGETEQEPLWLDDRPSTPESPVLDAPFSRAYRNSIKDAQSRVLGATSFRRRDL
EPGTPAASRXRERSQSTYLQPGPAASEGPGLTSASSLCSLREPSLQLRREAALLPAAAAG
DVGESPRAPRDRSSSFAGGHVFGELRRGDQAPRELLAGANYGPKGTQRVDRTPGEPSSWG
AAARRAGKSMSAEDLLERSDVLAVPVHVRSRSSPTADKRQDVVLGENNSFGPVKDPCYLA
GPGSRSVSCSERGHEDMLLLKHHPSLRWGGSGCKAVGDSSVPSECPGPLDHQRQASRTTP
CPRLLPTGMQGHLTDTRAASLTPLSSALPSPVPSSSQAATDQLTGRDCQTGQQPLPPYTS
AVTHRSNGHSLVQPASPRGHEPNSPEHGLEEATRKRVSLPQRPAPPRVKWAHTVREDSLP
EESSSPDFGDLKHYKTQQTPPSSGSTLDSPLGAPSTPGRISLRISESVLLASPPPREDDD
DEVFVKDLYPNAASSPTFELPPPPPPPLSQDTPVNSLDDFPPPPPHALYEAELDSEDHKE
PCTSSSKFAKVTVAKERPMPGTVHLVGSQIPASRSQTSIKGSEANETNPLSTMGTLPQLA
GALGKQPGPGQPSPIHNPVSGTQSLEKNVSSGPQKTSEDIRTEVLAKEIVHQDKSLADIL
DPDSRMKTTMDLMEGLFPRDVNLLKENSIKRKAMQRTVNCAGYESKRSEDKEAVGMLVNC
PAYYSVSAPKAELLNKIKDMPEEVNEEEEQVDVNEKKAELIGSLTHKLETLQEAKGSLLM
DIKLNNALGEEVEALISELCKPNEFDKYKMFIGDLDKVVNLLLSLSGRLARVENVLSGLG
EDASNEERSSLNEKRKVLAGQHEDARELKENLDRRERVVLDILANYLSEEQLQDYQHFVK
MKSTLLIEQRKLDDKIKLGQEQVKCLLESLPSDFIPKAGALVLPPNLESETAPVGGCTLS
GIFPALTSPL
Download sequence
Identical sequences ENSFCAP00000011938

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]