SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSFCAP00000011990 from Felis catus 76_6.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFCAP00000011990
Domain Number 1 Region: 154-228
Classification Level Classification E-value
Superfamily AN1-like Zinc finger 6.02e-30
Family AN1-like Zinc finger 0.0000807
Further Details:      
 
Domain Number 2 Region: 38-86
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.00000000000047
Family A20-like zinc finger 0.0091
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFCAP00000011990   Gene: ENSFCAG00000012931   Transcript: ENSFCAT00000012932
Sequence length 232
Comment pep:known_by_projection chromosome:Felis_catus_6.2:B3:1485576:1500157:1 gene:ENSFCAG00000012931 transcript:ENSFCAT00000012932 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MCILPQLSKLYLHHSPPSKSVQQRNMAQETNHSQVPMLCSTGCGFYGNPRTNGMCSVCYK
EHLQRQNSSNGRISPPAASVGTLSESFPVQCADGSVPDAQSPLDSTSASVQPSPVSNQSL
LSESVASSQVDSTSVDKAIPDTEDLQASVSDTAQQPSEEQSKSLEKPKQKKNRCFMCRKK
VGLTGFECRCGHVYCGVHRYSDVHNCSYNYKADAAEKIRKENPVVVGEKIQK
Download sequence
Identical sequences ENSFCAP00000011990

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]