SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSFCAP00000012080 from Felis catus 76_6.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFCAP00000012080
Domain Number 1 Region: 884-1191
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 1.63e-103
Family Higher-molecular-weight phosphotyrosine protein phosphatases 0.0000000000931
Further Details:      
 
Domain Number 2 Region: 1152-1450
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 1.5e-82
Family Higher-molecular-weight phosphotyrosine protein phosphatases 0.00000813
Further Details:      
 
Domain Number 3 Region: 22-183
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 6.33e-43
Family MAM domain 0.0000000274
Further Details:      
 
Domain Number 4 Region: 383-577
Classification Level Classification E-value
Superfamily Fibronectin type III 1.12e-28
Family Fibronectin type III 0.0018
Further Details:      
 
Domain Number 5 Region: 281-413
Classification Level Classification E-value
Superfamily Fibronectin type III 0.0000000000000213
Family Fibronectin type III 0.0041
Further Details:      
 
Domain Number 6 Region: 190-288
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000066
Family I set domains 0.0000147
Further Details:      
 
Weak hits

Sequence:  ENSFCAP00000012080
Domain Number - Region: 596-633,686-734
Classification Level Classification E-value
Superfamily Fibronectin type III 0.0434
Family Fibronectin type III 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFCAP00000012080   Gene: ENSFCAG00000013023   Transcript: ENSFCAT00000013027
Sequence length 1452
Comment pep:known_by_projection chromosome:Felis_catus_6.2:D3:37304288:38099382:-1 gene:ENSFCAG00000013023 transcript:ENSFCAT00000013027 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRRLGTCLATLAGLLLTAAGETFSGGCLFDEPHSACGYSQAEDDDFNWEQVNTLTKPTSD
PWMPSGSFMLVNTSGRPEGQRAHLLLPQLKENDTHCIDFHYFVSSKSNAAPGLLNVYVKV
NNGALGNPIWNISGDPTRTWNRAELAISTFWPNFYQVIFEVITSGHQGYLAIDEVKVLGH
PCTRTPHFLRIQNVEVNAGQFATFQCSAIGRTVAGDRLWLQGIDVRDAPLKEIKVTSSRR
FIASFNVVNTTKRDAGKYRCMIRTEGGVGISNYAELVVKEPPVPIAPPQLASVGATYLWI
QLNANSINGDGPIVAREVEYCTASGSWNDRQPVDSTSYKIGHLDPDTEYEISVLLTRPGE
GGTGSPGPALRTRTKCADPMRGPRKLEVVEVKSRQITIRWEPFGYNVTRCHSYNLTVHYC
YQVGGQEQVREEVSWDTDNSHPQHTITNLSPYTNVSVKLILMNPEGRKESQELIVQTDED
LPGAVPTESIQGSTFEEKIFLQWREPIQTYGVITLYEITYKAVSSFDPEIDLSNQSGRVS
KLGNETHFLFFGLYPGTTYSFTIRASTAKGFGPPATNQFTTKISAPSMPAYELETPLNQT
DNTVTVMLKPAHSRGAPVSVYQVVVEEERPRRTKKTTEILKCYPVPIHFQNASILNSQYY
FAAEFPANSLQAAQPFTIGDNKTYNGYWNTPLLPHKSYRIYFQAASRANGETKIDCVRVA
TKGAATPKPVPEPEKETDHTVKIAGVIAGILLFVIIFLGVVLVMKKRKLAKKRKETMSST
RQEMTVMVNSMDKSYAEQGTNCDEAFSFMDTHNLNGRSVSSPSSFTMKTNTLSTSVPNSY
YPDESHTMASDTSSLVQSHTYKKREPADVPYQTGQLHPAIRVADLLQHITQMKCAEGYGF
KEEYESFFEGQSAPWDSAKKDENRMKNRYGNIIAYDHSRVRLQTIEGDTNSDYINGNYID
GYHRPNHYIATQGPMQETIYDFWRMVWHENTASIIMVTNLVEVGRVKCCKYWPDDTEIYK
DIKVTLIETELLAEYVIRTFAVEKRGVHEIREIRQFHFTGWPDHGVPYHATGLLGFVRQV
KSKSPPNAGPLVVHCSAGAGRTGCFIVIDIMLDMAEREGVVDIYNCVRELRSRRVNMVQT
EEQYVFIHDAILEACLCGDTSVPASQVRSLYYDMNKLDPQTNSSQIKEEFRTLNMVTPTL
RVEDCSIALLPRNHEKNRCMDILPPDRCLPFLITIDGESSNYINAALMDSYKQPSAFIVT
QHPLPNTVKDFWRLVLDYHCTSVVMLNDVDPAQLCPQYWPENGVHRHGPIQVEFVSADLE
EDIISRIFRIYNAARPQDGYRMVQQFQFLGWPMYRDTPVSKRSFLKLIRQVDKWQEEYNG
GEGRTVVHCLNGGGRSGTFCAISIVCEMLRHQRTVDVFHAVKTLRNNKPNMVDLLDQYKF
CYEVALEYLNSG
Download sequence
Identical sequences ENSFCAP00000012080 XP_003995071.1.62641

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]