SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSFCAP00000012107 from Felis catus 76_6.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFCAP00000012107
Domain Number 1 Region: 120-178
Classification Level Classification E-value
Superfamily BPTI-like 8.66e-21
Family Small Kunitz-type inhibitors & BPTI-like toxins 0.00016
Further Details:      
 
Domain Number 2 Region: 49-106
Classification Level Classification E-value
Superfamily BPTI-like 2.13e-20
Family Small Kunitz-type inhibitors & BPTI-like toxins 0.0015
Further Details:      
 
Domain Number 3 Region: 220-277
Classification Level Classification E-value
Superfamily BPTI-like 1.99e-19
Family Small Kunitz-type inhibitors & BPTI-like toxins 0.00016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFCAP00000012107   Gene: ENSFCAG00000013056   Transcript: ENSFCAT00000013060
Sequence length 307
Comment pep:known_by_projection chromosome:Felis_catus_6.2:C1:174610525:174649478:-1 gene:ENSFCAG00000013056 transcript:ENSFCAT00000013060 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
IISTMKKEQIFWTSVYLLLNCASAPLSAVAEDAEEYTDVTDDGLPPLKLAHSFCALKADN
GPCRAILTKFFFNIHTQQCEEFIYGGCEGNQNRFESLEECEEKCIGDYVKTRTETTLEKE
KPEFCFLDEDSGICRGYMTRYFYSNDTKQCERFKYGGCLGNQNNFESLEECKNTCEDAVN
DNQLDMIVNNTLLSETTLDSVNNDSFTPQPTNVPSFFEFYGPSWCLTPADRGLCQANVSR
FYYNSVIGKCRPFKYSGCGGNENNFTSKNACLRTCKKGFIQRTSKGGLIKTKRKNKSYIV
TLVLNIL
Download sequence
Identical sequences ENSFCAP00000012107

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]