SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSFCAP00000012228 from Felis catus 76_6.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFCAP00000012228
Domain Number 1 Region: 1762-1903
Classification Level Classification E-value
Superfamily SET domain 1.31e-46
Family Histone lysine methyltransferases 0.0028
Further Details:      
 
Domain Number 2 Region: 79-176
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 3.8e-17
Family Canonical RBD 0.034
Further Details:      
 
Weak hits

Sequence:  ENSFCAP00000012228
Domain Number - Region: 1528-1538,1644-1661
Classification Level Classification E-value
Superfamily Formin homology 2 domain (FH2 domain) 0.000523
Family Formin homology 2 domain (FH2 domain) 0.051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFCAP00000012228   Gene: ENSFCAG00000013185   Transcript: ENSFCAT00000013189
Sequence length 1906
Comment pep:known_by_projection chromosome:Felis_catus_6.2:D3:7615237:7637888:-1 gene:ENSFCAG00000013185 transcript:ENSFCAT00000013189 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
EQSPPHHHHQQPPPQPGPSGERRNHHWRSYKLMIDPALKKGHHKLYRYDGQHFSLAMSSN
RPVEIVEDPRVVGIWTKNKELELSVPKFKIDEFYVGPVPPKQVTFAKLNDNIRENFLRDM
CKKYGEVEEVEILYNPKTKKHLGIAKVVFATVRGAKEAVQHLHSTSVMGNIIHVELDTKG
ETRMRFYELLVTGRYTPQTLPVGELDAVSPIVNETLQLSDALKRLKDGSLSAGCGSGSSS
VTPNSGGTPFSQDTAYSSSRLDTPNSYGQGTPLTPRLGTPFSQDSSYSSRQPTPSYLFSQ
DPTVTFKARRHESKFTDAYNRRHEHHYVHNSCAVTAVAGAPAAFRGSVDLPFGAVSSSGG
SSGPPFKAQPQDSATFAHTPPPAQATPAPGVTFKSAFSPYQTPVPPFPPPPEEPTTTTTF
GARESGEFRRAPAPPPLPPTEPLTKEKPGTPPGPPPPDANSMELGGRPTFGWSPEPCDSP
GTPTLESSPAGLEKPHDSLDSRIEMLLKEQRTKLPFLREQDSDTELQMEGSPISSSSSQL
SPLAPFGTNSQPGFRGPTPPSSRPSSTGLEDISPTPLPDSDEDDELDLGVGPRPPPEPGP
PDPSGLLGQTTEVALDLAGDRTPTSEKMDEGQQSSGEDMEISDDEMPSAPITSADCPKPG
VPPPPILPPLPPFPPGLFPVMQVDMSHVLGGQWGGMPMSFQMQTQMLSRLMTGQGACPYP
PFMAAAAAAASAGLQFVNLPPYRGPFSLSNSGPGRGQPWPPLPKFDPSVPPPGYVPRQED
PHKATVDGVLLVVLKELKAIMKRDLNRKMVEVVAFRAFDEWWDKKERMAKASLTPVKSGE
HKDEDRPKPKDRIASCLLESWGKGEGLGYEGLGLGIGLRGAIRLPSFKVKRKEPPDTASS
GDQKRLRPSTSVDEEDEESERERDRDMADAPCELAKRDPKGVGVRRRPARPLELDSGGEE
DEKESLSVSSSSSASSSSGSSTTSPSSSASDKEERESTEEEEEGEEEEEEEEDEEEEEEE
EEEGPRSQVSSSSTSSTSDKDDDAEDSDEQEESENEDEDIALSEASEKEEGDSDGEETVS
IATSKAGAGSSSESSESSEFESSSESSSSSSEDEEELVAREEEEEEEEEEEEQEEETTAA
DESMAPAAPDEDFEEDVATGAPVTESSVMEGEVDIEAEDGAPEERTSVLEEPPLPVCVEE
LAGCKEPSEEPGLKQEGARLLSPEPPAGETEARPPPSPEPAPEDDLEVAPESPTLLSLPL
QPPLPPPRPPRPPSPPPEPETPEPPHPPVPLEPPPEEQPPRTPGLCGSLAKSQSTETVPA
TPSGEPPLSGGSSGLSLSSPQVPGSPFSYPSQSPSLSSGGLPRTPGRDFTFTPTFPEPGG
PLLLPVCPLPAGRRDERSGPLTSPVLLETGLPLPLPLPLPLPLALPVPVLRAQTRAPTQL
PPLLPAPLAPCPPPIKRKPGRPRRSPPAVLSLDGPLVRPPGGATLGRDLLLLPGQPQTPV
FPSTHDPRAVTLDFRNAGIPAPPPPLPPQPPPPPPPPPVEPTKLPFKELENQWPSEAIPP
GPRGRDEVTEEFMDLAKVRGPWRRPPKKRHEDLVASASPELSPPQPLFRPRSEFEEMTIL
YDIWNGGIDEEDIRFLCVTYERLLQQDNGMDWLNDTLWVYHPPPTSLSSAKKKKRDDGIR
EHVTGCARSEGFYTIDKKDKLRYLNSSRASTDEPPTDTQGMSIPAQPHASTRAGSERRSE
QRRLLSSFTGSCDSDLLKFNQLKFRKKKLKFCKSHIHDWGLFAMEPIAADEMVIEYVGQN
IRQVIADMREKRYEDEGIGSSYMFRVDHDTIIDATKCGNFARFINHSCNPNCYAKVITVE
SQKKIVIYSKQHINVNEEITYDYKFPIEDVKIPCLCGSENCRGTLN
Download sequence
Identical sequences ENSFCAP00000012228

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]