SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSFCAP00000012325 from Felis catus 76_6.2

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSFCAP00000012325
Domain Number - Region: 104-113
Classification Level Classification E-value
Superfamily Formin homology 2 domain (FH2 domain) 0.000243
Family Formin homology 2 domain (FH2 domain) 0.13
Further Details:      
 
Domain Number - Region: 24-59
Classification Level Classification E-value
Superfamily SAP domain 0.00549
Family SAP domain 0.0072
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFCAP00000012325   Gene: ENSFCAG00000013289   Transcript: ENSFCAT00000013293
Sequence length 898
Comment pep:known_by_projection chromosome:Felis_catus_6.2:D1:110528438:110545124:1 gene:ENSFCAG00000013289 transcript:ENSFCAT00000013293 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAEHPEPPKGELQLPPPPPPGHYGAWAAQELQAKLAEIGAPIQGSREELVERLQTYTRQ
TGIVLNRPVLRGEDGDKAAPPPMSAQLSGIPMPPPPMGLPPLQPPPPPPPPPPGLGLGFP
MAVGPRPPNLGPPPPLRVGEPVALSEEERLKLAQQQAALLMQQEERAKQQGDHSLKEHEL
LEQQKRAAVLLEQERQQEIAKMGTPVPRPPQDMGQIGVRTPLGPRVLTVAAPVGPTPTVL
PMGAPVPRPRGPPPPPGDENREMDDPSVGPKIPQALEKILQLKESRQEEMNSQQEEEEME
TDTRSSLGQSASETEEDTVSVSKKEKNRKRRNRKKKKKPQRVRGASSESSGDREKESTRS
RGSDSPAADVEIEYVTEEPEIYEPNFIFFKRIFEAFKLTDDVKKEKEKEPEKLDKLENSA
APKKKGFEEEHKDSDDDSSDDEQEKKPEAPKLSKKKLRRMNRFTVAELKQLVARPDVVEM
HDVTAQDPKLLVHLKATRNSVPVPRHWCFKRKYLQGKRGIEKPPFELPDFIKRTGIQEMR
EALQEKEEQKTMKSKMREKVRPKMGKIDIDYQKLHDAFFKWQTKPKLTIHGDLYYEGKEF
ETRLKEKKPGDLSDELRISLGMPVGPNAHKVPPPWLIAMQRYGPPPSYPNLKIPGLNSPI
PESCSFGYHAGGWGKPPVDETGKPLYGDVFGTNAAEFQTKTEEEEIDRTPWGELEPSDEE
SSEEEEEEESDEDKPDETGFITPADSGLITPGGFSSVPAGMETPELIELRKKKIEEAMDG
SETPQLFTVLPEKRTATVGGAMMGSTHIYDMSTVMSRKGPAPELQGVEVALAPEELELDP
MAMTQKYEEHVREQQAQVEKEDFSDMVAEHAAKQKQKKRKAQPQDSRGGSKKYKEFKF
Download sequence
Identical sequences ENSFCAP00000012325

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]