SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSFCAP00000012473 from Felis catus 76_6.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFCAP00000012473
Domain Number 1 Region: 1712-1864
Classification Level Classification E-value
Superfamily Spectrin repeat 1.78e-32
Family Spectrin repeat 0.000024
Further Details:      
 
Domain Number 2 Region: 415-571
Classification Level Classification E-value
Superfamily Spectrin repeat 2.33e-32
Family Spectrin repeat 0.00026
Further Details:      
 
Domain Number 3 Region: 1498-1654
Classification Level Classification E-value
Superfamily Spectrin repeat 6.84e-31
Family Spectrin repeat 0.00016
Further Details:      
 
Domain Number 4 Region: 210-358
Classification Level Classification E-value
Superfamily Spectrin repeat 1.19e-30
Family Spectrin repeat 0.00033
Further Details:      
 
Domain Number 5 Region: 748-887
Classification Level Classification E-value
Superfamily Spectrin repeat 1.55e-29
Family Spectrin repeat 0.00049
Further Details:      
 
Domain Number 6 Region: 1392-1538
Classification Level Classification E-value
Superfamily Spectrin repeat 4.45e-28
Family Spectrin repeat 0.00016
Further Details:      
 
Domain Number 7 Region: 521-675
Classification Level Classification E-value
Superfamily Spectrin repeat 7.72e-28
Family Spectrin repeat 0.00014
Further Details:      
 
Domain Number 8 Region: 112-251
Classification Level Classification E-value
Superfamily Spectrin repeat 1.83e-27
Family Spectrin repeat 0.0017
Further Details:      
 
Domain Number 9 Region: 1816-1973
Classification Level Classification E-value
Superfamily Spectrin repeat 3.53e-27
Family Spectrin repeat 0.0000735
Further Details:      
 
Domain Number 10 Region: 1286-1429
Classification Level Classification E-value
Superfamily Spectrin repeat 5.37e-27
Family Spectrin repeat 0.0021
Further Details:      
 
Domain Number 11 Region: 10-145
Classification Level Classification E-value
Superfamily Spectrin repeat 2.23e-25
Family Spectrin repeat 0.00000124
Further Details:      
 
Domain Number 12 Region: 681-783
Classification Level Classification E-value
Superfamily Spectrin repeat 1.02e-22
Family Spectrin repeat 0.00042
Further Details:      
 
Domain Number 13 Region: 2085-2198
Classification Level Classification E-value
Superfamily Spectrin repeat 1.7e-22
Family Spectrin repeat 0.00059
Further Details:      
 
Domain Number 14 Region: 969-1050
Classification Level Classification E-value
Superfamily SH3-domain 1.08e-19
Family SH3-domain 0.00015
Further Details:      
 
Domain Number 15 Region: 2204-2311
Classification Level Classification E-value
Superfamily Spectrin repeat 2.36e-17
Family Spectrin repeat 0.0033
Further Details:      
 
Domain Number 16 Region: 1942-2078
Classification Level Classification E-value
Superfamily Spectrin repeat 2.36e-16
Family Spectrin repeat 0.0014
Further Details:      
 
Domain Number 17 Region: 891-963
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000000000187
Family Spectrin repeat 0.0016
Further Details:      
 
Domain Number 18 Region: 2304-2434
Classification Level Classification E-value
Superfamily EF-hand 0.00000000000115
Family Calmodulin-like 0.09
Further Details:      
 
Domain Number 19 Region: 1073-1160
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000036
Family Spectrin repeat 0.0024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFCAP00000012473   Gene: ENSFCAG00000013442   Transcript: ENSFCAT00000013452
Sequence length 2466
Comment pep:known_by_projection chromosome:Felis_catus_6.2:F1:64997657:65064514:1 gene:ENSFCAG00000013442 transcript:ENSFCAT00000013452 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
METSGPKVLETAEAIQERRREVLTRYQRFKELVAERGQKLEESYHYQVFRRDADDLEKWV
LEKLKIADDKSYEDLTNIQGKYRKHESLEAEIQAKSRVIPELEEIRETRFAEGHFAHEDT
KAHLEQLRTLWDLLLELTRERGALLLRALRLQQYLQECADTLEWIGDKEAIVTSAELGED
WERTEVLHKKFEEFQADLETQKRKLDGMNQYANQCAEEKHPDLPLIKLKQDEVNTAWKRL
LSLAGQRQETLANAADLQRFKRDVTEAIQWIKEKEPQLTSEDYGKDLISSEALFHSHKGL
ERNLAVMQDKVKELSAKADRLMLSHPSDASQIQQMKEELVSNWEHIRALAASRYEKLQAS
YWYQRFLSDYEELSGWMKEKSALINADELPTDVAGGEALLDRHGQHKHEIDSYDDRFQSA
EETGRELLDVGHEASDEVLEKMTILANDWAALRGLWDQRKHQYEQCLYLHLFYRDSEQVD
SWMSRQEAFLEDEDLGNSLGSVEALLQKHDDFEEAFNAQEEKITTLDNNATKLIDNDHYD
SEKIAALRDSLLSRRDALRARAAMRRRLLEDSWLLQKLYEDSDDLKNWVNKKKKLADDED
YKDTQNLKSRVKKQEDFKKELQDNQRLLNTLEKTGQEMIEANHYAADKVTARVAEVVSLW
KELLAAMEQKGTQLHDANQELQFKNNAEDLEHWLDKAEEQAASEDYGKGLADIQSLLRKH
GLLESAVATRQDQVDSLTDRAAYFEEIGHPNAGDIQARRESLVSRFEALKEPMATRKKKL
IDFLHLLQLFRDTEDEEAWIEETEPSVASTYLGKDLIASKKLLNRHQVIQDDIANHEPHV
RMITERGNKMVEEGHFAAEDVASKVKALNDNMESLQARAARRQNDLEANVQFQQYLADLH
EAEAWIQEKAPIVDNTNYGADEEAAGALLKKHEAFLVDLSAFGNSMQALRDQAEACQQQQ
AAPVEGAAREQRVVALYDFEARSNREVTMKKDDVLTLLSSINKDWWKVEAGDHQGFVPAV
YVRKLAHDEFPTLPQRRREEPGSITERQEQIEKQQRRVSCFVSHDAFPFSLVPRRYRSLL
DRAEERRCRLLQRYNEFLLAYEAGDMLEWIQEKKAENTGVELDDVWELQKKFDEFQTDLK
ANEPRLRDINKVADQLERAEGLKLASDRSLQQQTSVAGLGMNEGQAQTIQERKKPVQFRK
RSRGNSHDELNNRWDSLQRLAEEQRQLLGSAHAVQMFHREADDTKEQIEKKLQALRAADP
GSDLFSVQALQRQHEVFERDLMPLEEKVTMLRETAERLSESHPDAAGDLQNQGMELKETW
DDLLGCTEDRKHDLNEARQFYTFLNRARDLENWMSGIGGMVSSEELAEDLTGTEILLERH
SGHYADMEAEAPTFQALEEFGGELVRSGHRDSPEIQEKLEAVRQEKGDLEKAWDQRKKML
HQCLELQLFHGSCDQAESWMMARENFLRSERAGPLDSLEALMKKRDDLEKAINAQDKKIT
ELGNVAERLIADDHYAKEEIAARLQRVLDRWKALKKLLVAEQTKLGDYADVKQFYRDLED
LEEWIGEMLPTACDESYKDPTNIQRKYLKHKAFENEVKGRTEQVKGVLTLGNSLIERQAC
DGNEETVRKQLQELQRQWDYLLEKTADKGEKLDEASRQQRFNTSIQDFKFWLSEAETLLA
MKDQARDLASAGNLLKKHQLLETEMSAREDALKDLNESATHLLSSGTFNVDQIVEQRDNV
NERFLNVRNLAAAHHETLKEAYALFQFFQDLDDEESWIEEKLLRVRSQDYGRDLQGVQNL
LRKHKRLAGELQAHEPTIQNILDAAERLGDKAAVGREEIQERLTHLFQQWEKLKELASTR
GLRLEESLEYLKFMENAEEEEAWISEKEAMVARGGSGDTLAATQSLLKKHKALENDFAVH
ETRVQDVCAQGEDILNKEKSQHMEKVATKIQTLTEKIPSLAKAMAVWKLQLEDDYDFQQF
NWKADVVEAWIAEKEASLKTNGNDTDLTASLALLAKQDTLDASLQSFQQDRLSEITDLKD
QLVAAQHSQTKAIEERHAALLRRWGELLEASAAHRQNLLEKQLPLKKAEELFMEFAHKAS
AFNHWCENAKEDLSEPVHCVSLNEIRKLQKDQEAFLASLVGAQSDFNYLLELDQQIKALD
VPSSPYTWLTMEVLENVWKHLHGIIKEREQELQKEEERQVKNFEMCQEFEQNASAFLQWI
LETRAYFLDGSLLKETGTLESQLEANKRKQKEIQAMKRQLTKIEDLGDNLEEALVLDIKY
STIGLAQQWDQLHQLGTRMQHNLEQQIQAKDTIGVSEETLKEFSTTYKHFDENLTGRLSH
RDFRSCLRGLNYYLPMVEDDEPEPKFEKFLDVVDPGRKGYITLEDYTSFLIDKESENIKS
SDEIENGFQALAEGKAYITKDDMKQALTPEQVQFCASHMQEYVDPRGQRHLAGYDYVGFT
SSYFGN
Download sequence
Identical sequences ENSFCAP00000012473

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]