SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSFCAP00000012521 from Felis catus 76_6.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFCAP00000012521
Domain Number 1 Region: 6-309
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 9.42e-70
Family Protein kinases, catalytic subunit 0.0000000052
Further Details:      
 
Weak hits

Sequence:  ENSFCAP00000012521
Domain Number - Region: 315-388
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00767
Family Spectrin repeat 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFCAP00000012521   Gene: ENSFCAG00000013501   Transcript: ENSFCAT00000013503
Sequence length 413
Comment pep:known_by_projection chromosome:Felis_catus_6.2:A2:2937025:2947295:-1 gene:ENSFCAG00000013501 transcript:ENSFCAT00000013503 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSTFRQEDVEDYYEMGEELGSGQFAIVRKCRQKGTGKEYAAKFIKKRRLSSSRRGVSREE
IEREVNILREIRHPNIITLHDIFENKTDVVLILELVSGGELFDFLAEKESLTEDEATQFL
KQILDGVHYLHSKRIAHFDLKVSRAGARPGRVTWGVGAARGSGSERXNIFGTPEFVAPEI
VNYEPLGLEADMWSIGVITYILLSGASPFLGETKQETLTNISAVNYDFDEEYFSNTSELA
KDFIRRLLVKDPKRRMTIAQSLEHSWIKAIRRRNVRREDGGRKPERRRLKTARLKEYTIK
SHSSMPPNNTYVSFERFSKVLEEVAAAEEGLRGLEHSRRLFHEDIEALTAIYEEKEAWYR
EENESIGQDLRRLRQELHKTEALRRQAQEEAKGALLGASGLKRRFSRLENRYE
Download sequence
Identical sequences ENSFCAP00000012521

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]