SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSFCAP00000012656 from Felis catus 76_6.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFCAP00000012656
Domain Number 1 Region: 160-181,324-351
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000106
Family Classic zinc finger, C2H2 0.038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFCAP00000012656   Gene: ENSFCAG00000013648   Transcript: ENSFCAT00000013652
Sequence length 583
Comment pep:known_by_projection chromosome:Felis_catus_6.2:A2:11193141:11200241:-1 gene:ENSFCAG00000013648 transcript:ENSFCAT00000013652 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGVTEWYVNGSPIDTLREILKRRTQSRPGGPPNPPGPSPKALAKVMGSGGPGSSLEARSP
ADLHLSPLAKKLPPPPGSPLGHSPTASPPPTARKMFPGLAAPSLPKKLKPEQMRVEIKRE
MLPGALHGEPHPSEGPWAAPREDMAPLNLSSRAEPVRDIRCEFCGEFFENRKGLSSHARS
HLRQMGVTEWSVNGSPIDTLREILKKKSKPCLIKKEPPAGDLAPALAEDGPPTAAPGPVQ
APLPLAPMAGRPGKPGAGPAQVPRELSLAPITGAKATATGYLGSVAAKRPLQEDRLLPAE
VKAKTYIQTELPFKAKTLHEKTSHSSTEACCELCGLYFENRKALASHARAHLRQFGVTEW
CVNGSPIETLSEWIKHRPQKVGAYRSYIQGGRPFTKKFRSAGHGRDSDKRPPLGLAPGGL
AVVGRSAGGEPGPEAGRAADSGERPLAASPPGTVKAEEHQRQNINKFERRQARPPDASAV
RGGEEANDLQQKLEEVRQPPPRVRPVPSLVPRPPQTSLVKFVGNIYTLKCRFCDVEFQGP
LSIQEEWVRHLQRHILEMNFSKADPPPEEPRAPQAQTAAAEAP
Download sequence
Identical sequences ENSFCAP00000012656

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]