SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSFCAP00000012691 from Felis catus 76_6.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFCAP00000012691
Domain Number 1 Region: 323-525
Classification Level Classification E-value
Superfamily p53-like transcription factors 0.00000000000000112
Family DNA-binding domain from NDT80 0.016
Further Details:      
 
Weak hits

Sequence:  ENSFCAP00000012691
Domain Number - Region: 171-181
Classification Level Classification E-value
Superfamily Formin homology 2 domain (FH2 domain) 0.00445
Family Formin homology 2 domain (FH2 domain) 0.13
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFCAP00000012691   Gene: ENSFCAG00000013683   Transcript: ENSFCAT00000013687
Sequence length 1136
Comment pep:known_by_projection chromosome:Felis_catus_6.2:D1:107260955:107279905:1 gene:ENSFCAG00000013683 transcript:ENSFCAT00000013687 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GHDINGALEPSNIDTSILEEYISKEDASDLCFPDISAPASAASYPHGQPAIPGSSGGHHL
SPSGGGPSPGRHGPLPAPSYSAPLNCNNNNAMGTAPKPFLGGSGPPIKAEPKAPYAPGTL
PDSPPDSGSEAYSPQQVNDPHLLRTITPESLCHVGVPSRLEHPPPPPAHLPGPPPPPPPP
PHYPVLQRDLYMKAEPPMPPYAAMGQGLVPTDLHHTQQSQMLHQLLNQHGAELPTHPSKK
RKHSESPPNTLNAQMLNGMIKQEPGTATSLPPHPARAPSPPWPPQGPLSPGPGSLPLSIA
RVQTPPWHPPGAPSPGLLQDNDSLSGSYLDPNYQSIKWQPHQQNKWATLYDANYKELPML
TYRVDADKGFNFSVGDDAFVCQKKNHFQVTVYIGMLGEPKYVKTPEGLKPLDCFYLKLHG
VKLEALNQSINIEQSQSDRSKRPFNPVTVNLPPEQVTKVTVGRLHFSETTANNMRKKGKP
NPDQRYFMLVVALQAHAQNQNYTLAAQISERIIVRASNPGQFESDSDVLWQRAQVPDTVF
HHGRVGINTDRPDEALVVHGNVKVMGSLMHPSDLRAKEHVQEVDTTEQLKRISRMRLVHY
RYKPEFAATAGIEATAPETGVIAQEVKEILPEAVKDTGDVVFANGKTIENFLVVNKERIF
MENVGAVKELCKLTDNLETRIDELERWSHKLAKLRRLDSLKSTGSSGAFSHAGSQFSRAG
SVPHKKRPPKVASKSSSVVPDQACISQRFLQGTIIALVVVMAFSVVSMSTLYVLSLRTEE
DLVETDGSFAVSTSCLLALLRPQHPGGSEARCPWSSQSFGTTQLRQSPVTTGLPGTRPSL
LLVTTGLSSSAPGPVIPTLDLCSSRPCPVICCSSSTPSPTPAPSLGSSFNPGHGLSPSPS
PSTNRSGPGQMALLPVTNIRAKSWGLSANGIGHSKHPKSSEPLASPEVPFPGGQGKAKNS
PSLGLHGRARRGLPQPGLSPARPTRAQGQPASLLADPVPSLTSIQVLENSMPITSQYCAP
EDACRPGNFTYHIPVSSGTPLHLSLTLQMNSSSPVSVVLCSLMSKEQPCEERDFPQSLHT
YQDTQGTSHQWPVTILSFREFTYHFRVALLGQANCSVEAPVLPATDYYFHFYRLCD
Download sequence
Identical sequences ENSFCAP00000012691

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]