SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSFCAP00000012755 from Felis catus 76_6.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFCAP00000012755
Domain Number 1 Region: 67-154
Classification Level Classification E-value
Superfamily PDZ domain-like 7.36e-25
Family PDZ domain 0.0013
Further Details:      
 
Domain Number 2 Region: 149-279
Classification Level Classification E-value
Superfamily PH domain-like 8.05e-16
Family Pleckstrin-homology domain (PH domain) 0.016
Further Details:      
 
Weak hits

Sequence:  ENSFCAP00000012755
Domain Number - Region: 295-421
Classification Level Classification E-value
Superfamily PH domain-like 0.00415
Family Pleckstrin-homology domain (PH domain) 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFCAP00000012755   Gene: ENSFCAG00000013751   Transcript: ENSFCAT00000013756
Sequence length 539
Comment pep:known_by_projection chromosome:Felis_catus_6.2:A3:141651674:141778747:-1 gene:ENSFCAG00000013751 transcript:ENSFCAT00000013756 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ARGRGPVVAPTSLRSRPWPVSALPPQTRTGLALLHHEGSGSPCDVRLKLTREVLTIQKQD
VVCVRGSSHGAHHRTVTLRRQPVGGLGLSVKGGAEHRVPVVISKIFRGHAADQTGMLFVG
DAVLQVNGINVEHATHEEVVHLLRNAGDEVAITVDYLREAPAFLKLPLGSPGPAGDHSSG
ASSPLFDSGLHLNSNPSSTDSPSPSSPAADAPQYEKRWLDTLSVPLSMARISRCKAGTGK
CRSGAFQVLAVDGVRTGVLQFHTARESADWLRAVSATISDLTLESMKMVNEGCSPCDQVV
HMGWVRERLEGTSSRETFRSKFLALKGSLLYVFSTAPVSTLDWVRAEKTYNLCEVLFKLH
KLWLADDGWLHEACHLGPPGFAPQRPFSFSVLVGHGQSRVFSVDLGSELAAWERSFQRAT
FKEVQRSRSKTYTCSWQGEMLCFTVDFALGFTCSDSKTKNVLWRFKFSQLKGSSDDGNAR
VKLLFQHPDTKQIEVKELEFPDLTAVLHCVHAFLAAKVASVDPAFMDSQSFARKSASAE
Download sequence
Identical sequences ENSFCAP00000012755

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]