SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSFCAP00000012816 from Felis catus 76_6.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFCAP00000012816
Domain Number 1 Region: 199-340
Classification Level Classification E-value
Superfamily PH domain-like 1.2e-44
Family Third domain of FERM 0.00000011
Further Details:      
 
Domain Number 2 Region: 89-198
Classification Level Classification E-value
Superfamily Second domain of FERM 2.75e-38
Family Second domain of FERM 0.000000594
Further Details:      
 
Domain Number 3 Region: 490-577
Classification Level Classification E-value
Superfamily Moesin tail domain 4.71e-33
Family Moesin tail domain 0.0000039
Further Details:      
 
Domain Number 4 Region: 2-87
Classification Level Classification E-value
Superfamily Ubiquitin-like 1.14e-25
Family First domain of FERM 0.0000114
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFCAP00000012816   Gene: ENSFCAG00000013821   Transcript: ENSFCAT00000013825
Sequence length 577
Comment pep:known_by_projection chromosome:Felis_catus_6.2:X:53897284:53962444:1 gene:ENSFCAG00000013821 transcript:ENSFCAT00000013825 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPKTINVRVTTMDAELEFAIQPNTTGKQLFDQVVKTIGLREVWFFGLQYQDTKSFSTWLK
LNKKVTAQDVRKESPLLFKFRAKFYPEDVSEELIQDITQRLFFLQVKEGILNDDIYCPPE
TAVLLASYAVQSKYGDFNKEVHKSGYLAGDKLLPQRVLEQHKLNKDQWEERIQVWHEEHR
GMLREDAVLEYLKIAQDLEMYGVNYFSIKNKKGSELWLGVDALGLNIYEQNDRLTPKIGF
PWSEIRNISFNDKKFVIKPIDKKAPDFVFYAPRLRINKRILALCMGNHELYMRRRKPDTI
EVQQMKAQAREEKHQKQMERALLENEKKKREMAEKEKEKIEREKEELMERLKQIEEQTKK
AQHELEEQTRRALELEQERKRAQSEAEKLAKERQEAEEAKEALLQASQDQKKTQEQLALE
MAELTARISQLEMARQKKESEAVEWQQKAQMVQEDLEKTRAELKTAMSTPHVAEPAENEQ
DEQDENGAEASADLRADAMAKDRSEEERTTEAEKNERVQKHLKALTSELANARDESKKTA
NDMIHAENMRLGRDKYKTLRQIRQGNTKQRIDEFESM
Download sequence
Identical sequences M3WJI8
ENSFCAP00000012816 XP_004000620.1.62641

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]