SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSFCAP00000012925 from Felis catus 76_6.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFCAP00000012925
Domain Number 1 Region: 29-89
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 1.06e-26
Family KRAB domain (Kruppel-associated box) 0.001
Further Details:      
 
Domain Number 2 Region: 159-216
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 0.000000000209
Family KRAB domain (Kruppel-associated box) 0.0075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFCAP00000012925   Gene: ENSFCAG00000013938   Transcript: ENSFCAT00000013942
Sequence length 276
Comment pep:novel chromosome:Felis_catus_6.2:E2:2111276:2124087:-1 gene:ENSFCAG00000013938 transcript:ENSFCAT00000013942 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ALPSRGPALLQDRTQKQEAAGTGPELKALSRSLVTFGDVAVDFSQEEWEWLNSAQRNLYR
SVMLENYRNLASLGLCVSKPDMISSLEQRKEPWMVKRRLTRGRGPDLEAGPETKELPAKK
DICKEKLSQVVIMERLTNHSLECSILGEDLDYGALLERPPGLVTITNMAVDFSQQLDPAQ
KSFCKNVMWENRSDLGSVGAGPCVSKADLVSLLQQEKEPWVVDRELPKGLGSGECGRPGP
NRCCTWGWVLTEVRETHRTSPSSPGLDRKWRSGLQK
Download sequence
Identical sequences ENSFCAP00000012925

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]