SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSFCAP00000012976 from Felis catus 76_6.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFCAP00000012976
Domain Number 1 Region: 137-406
Classification Level Classification E-value
Superfamily EndoU-like 1.31e-96
Family Eukaryotic EndoU ribonuclease 0.00000581
Further Details:      
 
Domain Number 2 Region: 21-60
Classification Level Classification E-value
Superfamily Somatomedin B domain 0.000000000144
Family Somatomedin B domain 0.0012
Further Details:      
 
Domain Number 3 Region: 89-128
Classification Level Classification E-value
Superfamily Somatomedin B domain 0.000000000353
Family Somatomedin B domain 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFCAP00000012976   Gene: ENSFCAG00000013989   Transcript: ENSFCAT00000013996
Sequence length 412
Comment pep:known_by_projection chromosome:Felis_catus_6.2:B4:77116757:77132156:-1 gene:ENSFCAG00000013989 transcript:ENSFCAT00000013996 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRARVPLIVAMLCSLAWAGKMESCASRCNEKFNRDAACQCDRRCPRHGDCCEDYDQLCTV
DEDPNKPEPFLELEEETEAPASHLYSAPSSCRDRCQEAFDRHQPCHCDARCPEFGNCCKD
FESLCGHEGFSYSSDAITKEELQSISEKIYRADTNKAQKEDVIINSQNRISPSETRDQVD
CCPEPLFTYVNERLFSKPTYAAFINLLNNYQRATGRGEHFSAQQLAEQDAFLREVMKTAV
MKELYAFLHHQNRYSSEQEFVSDLKNMWFGLYSRGNGEEDSSGFEHVFSGEVKKGKVTGF
HNWIRFYMQEKEGLVDYYSHIYDGPWDSYPDVLAMQFNWDGYYKEVGSAFIGSSPEFELA
LYSLCFIARPGKVCQLSLGGYPLAIQTYTWDKSTYGNGKKYIATAYVVSSTQ
Download sequence
Identical sequences M3WJV9
ENSFCAP00000012976 XP_003988642.1.62641

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]