SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSFCAP00000012997 from Felis catus 76_6.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFCAP00000012997
Domain Number 1 Region: 513-705
Classification Level Classification E-value
Superfamily Hemopexin-like domain 7.33e-57
Family Hemopexin-like domain 0.0000000277
Further Details:      
 
Domain Number 2 Region: 115-231,395-447
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 1.08e-33
Family Matrix metalloproteases, catalytic domain 0.00000067
Further Details:      
 
Domain Number 3 Region: 336-390
Classification Level Classification E-value
Superfamily Kringle-like 1.46e-21
Family Fibronectin type II module 0.00013
Further Details:      
 
Domain Number 4 Region: 274-331
Classification Level Classification E-value
Superfamily Kringle-like 1.23e-20
Family Fibronectin type II module 0.00013
Further Details:      
 
Domain Number 5 Region: 218-273
Classification Level Classification E-value
Superfamily Kringle-like 7.71e-20
Family Fibronectin type II module 0.00015
Further Details:      
 
Domain Number 6 Region: 31-104
Classification Level Classification E-value
Superfamily PGBD-like 4.4e-17
Family MMP N-terminal domain 0.0000781
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFCAP00000012997   Gene: ENSFCAG00000014014   Transcript: ENSFCAT00000014019
Sequence length 706
Comment pep:known_by_projection chromosome:Felis_catus_6.2:A3:14893716:14900785:-1 gene:ENSFCAG00000014014 transcript:ENSFCAT00000014019 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSPRQPLVLALLVLGCCTAAPRPRKPTVVVFPGDLRTNLTDRQLAEEYLYRYGYTHVAEI
SDDQQSLSRGLRLLQRRLALPETGELDRTTLEAIRTPRCGVPDLGKFQTFEGDLKWHHHN
ITYWIQNYSEDLPRDVIDDAFARAFAAWSAVTPLTFTRVYGLEADIVIQFGVREHGDGYP
FDGKDGLLAHAFPPGPGIQGDAHFDDEELWSLGKGVVVPTYFGNAGGAACHFPFTFEGRS
YSACTTDGRSDDMLWCSTTADYDTDRRFGFCPSERLYTQDGNGEGKPCVFPFTFEGHSYS
ACTTEGRSDGYRWCATTANYDQDKLYGFCPTRADSTVTGGNSAGELCVFPFIFLGKEYST
CTREGRGDGHLWCATTSNFDRDKKWGFCPDQGGYSLFLVAAHEFGHALGLDHSSVPEALM
YPMYSFTEGPPLHEDDVKGIQHLYGPRPEPEPRPPTTTTPESQPTVCTTGPPTTRPPERP
TAGPTGPPSAGPTGPPTAGPSEAPTVSLDPAEDVCNVNVFDAVAEIGNLLHFFKDGKYWQ
FSENPGRRVRGPFLITNKWPALPRKLDSAFEDPLTKKTFFFSGRQVWVYTGTSVLGPRRL
DKLGLGPEVAQITGALPRSGGKVLLFSRQRFWRFDVKTQTVDAKSAGQVEQMFPGVPLNT
HDIFQYQEKAYFCQDRFYWRVSSRNEVNQVDQVGYVTFDLLQCPED
Download sequence
Identical sequences ENSFCAP00000012997

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]