SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSFCAP00000013062 from Felis catus 76_6.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFCAP00000013062
Domain Number 1 Region: 470-535,577-675
Classification Level Classification E-value
Superfamily PH domain-like 3.34e-30
Family Pleckstrin-homology domain (PH domain) 0.0048
Further Details:      
 
Domain Number 2 Region: 686-807
Classification Level Classification E-value
Superfamily PH domain-like 9.51e-19
Family Pleckstrin-homology domain (PH domain) 0.011
Further Details:      
 
Domain Number 3 Region: 1095-1227
Classification Level Classification E-value
Superfamily Second domain of FERM 1.96e-18
Family Second domain of FERM 0.0071
Further Details:      
 
Weak hits

Sequence:  ENSFCAP00000013062
Domain Number - Region: 18-128,582-602
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 0.00022
Family BAR domain 0.067
Further Details:      
 
Domain Number - Region: 997-1073
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.00344
Family Ubiquitin-related 0.047
Further Details:      
 
Domain Number - Region: 1231-1291
Classification Level Classification E-value
Superfamily PH domain-like 0.0164
Family Third domain of FERM 0.069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFCAP00000013062   Gene: ENSFCAG00000014084   Transcript: ENSFCAT00000014088
Sequence length 1366
Comment pep:known_by_projection chromosome:Felis_catus_6.2:B3:114877701:114926189:1 gene:ENSFCAG00000014084 transcript:ENSFCAT00000014088 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAELKVETRASVDWQKRCLALETQLFRFRLQASKIRELLADKMQELEQRLLEAEQRAENA
ETQVGVMEEKVKLSNLKNVDSAGSLHRKYQELLKAMQSKDELISQLEAQLEKQKQMRAEE
AKVVQEKAAKIKEWVTLKLAELEMENQHLRSSNQQLVEQVGALQDALEALQMAPSGKLLV
APQETPEQDSSSSGPGTQPTGQDRGPQAQGALKAAMPAPSTGALQSKDCVPKAGISLEDS
SSIMVHPGEISEAKTFPPRLGREGSPRRLCVKSRTHRHGSASWGEGLVIAQGGTLPGTKN
SAREAGPGCSLTLPKVRAPSNPRDSIQLAKRHHSQPQVGPGPFNHVVSIEVGTLSALHPS
SLPEVEARAELREEPENMEMEEQPPAGRKEERKSPKAPRAEPEEVDLGNKPPTPPLHRFP
SWESRIYAVAMAGMRLSDVSPRTIATCCASSPPALASPGPFSGLVYKNVTVPVYTALKGR
ATQISTVPFVDESSGSDDDCSSQASFRTSVPCSESRKTSGLGSPRAIKRAGVSMSSLSSE
GDYAIPPDACSLDSDYSEPEHKLQRTSSYSTEGLGLGGESLEKSGYLLKMGSRVKTWKRR
WFVLRQGQIMYYKSPSDVIRKPQGQVELNSRCQIVRGEGAQTFQLISEKKTYYLTADSPS
LLEEWIRVLQSLLKVQAIGPLALPQGGIKPTVKGWLTKVKHGHSKLVWCALVGRTFYYYR
SHEDKRPLGHLPVRDARIEEVDRSCDSDEDYEAGGTRQLLSSHCTLVIHPREHSPTYLLI
GTKHEKDTWLYHLTVAAGGSSARVGTAYEQLIGKLMDGEGDPDSPLWRHPMLCYSKDGLY
TSLTTLPSEALQTEALKLFKSCQLFINVPVEAASIDYHVSLAQTALQVCLVHPELQSEIY
CQLMKQTSCRPPQKYSLMQCWQLLALCAPLFLPQHHFLWYIKQQLQRHADPTNETGQYAT
YCQRAVERTLQVGEREARPSRMEVVSILLRNPFHHSLPFSIPVHFASGTYQVVGFDGSST
VDEFLQRLNQETGMRKSSHSGFALFTDDPSGRDLEHCLQGSIKICDAISKWEQALKELHS
GKAEGGTRVVKLMYKNRLYFRSQVKGETERERLLLASQTSGEIVAGRFPVNKELALEMAA
LMAQVEYGDLERPTPPGPGSTPPAKLQHHLQQVLDRFYPRRYRHGAPPEQLRHLADLLTT
KWTALQGCSPPECIRIYLTVARKWPFFGAKLFAAQPAQLSSKENALVWIAVNEDGVSILD
HSTMHVHVTYPYSSVMTFGGCRDDFMLVIRSILDQSSGKGHTEKLLFRMAAPKIAEATFI
MASYMNHCSPTVNPPTNPPAARQLRELDRQQFFASVPCAARGPTLL
Download sequence
Identical sequences XP_019688731.1.62641 ENSFCAP00000013062

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]