SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSFCAP00000013106 from Felis catus 76_6.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFCAP00000013106
Domain Number 1 Region: 151-522
Classification Level Classification E-value
Superfamily Alkaline phosphatase-like 2.29e-93
Family Phosphonoacetate hydrolase 0.026
Further Details:      
 
Domain Number 2 Region: 618-854
Classification Level Classification E-value
Superfamily His-Me finger endonucleases 1.24e-23
Family DNA/RNA non-specific endonuclease 0.011
Further Details:      
 
Domain Number 3 Region: 51-99
Classification Level Classification E-value
Superfamily Somatomedin B domain 0.0000000262
Family Somatomedin B domain 0.0031
Further Details:      
 
Domain Number 4 Region: 100-140
Classification Level Classification E-value
Superfamily Somatomedin B domain 0.000000102
Family Somatomedin B domain 0.0045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFCAP00000013106   Gene: ENSFCAG00000014130   Transcript: ENSFCAT00000014135
Sequence length 876
Comment pep:known_by_projection chromosome:Felis_catus_6.2:B2:120941656:121015578:1 gene:ENSFCAG00000014130 transcript:ENSFCAT00000014135 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MESMQTLSMEEPVKRSTVRTYKIICIVLLALLVIVSLGLGLGLGLRRQEEQGSCRKKCFD
SSFRGLESCRCDMECKQRGDCCWDFEDTCVKSTRIWTCNRFRCGETRLDSSLCSCSDDCL
QRKDCCADYNSVCQGETPWVKEECGTAQPSQCPEGFELPPVILFSMDGFRAEYLQTWDTL
LPNIHKLKTCGIHSKYMRAVYPTKTFPNHYTIVTGLYPESHGIIDNNMYDVNLNKNFSLS
SKEKNNPAWWQGQPIWLTATYQGLKAGSFFWPGSDVAINGSFPSIYMSYNRSIPYEERIF
TLLKWLDLPKAERPAFYTIYVEEPDSAGHKNGPVSAGVIQALQLVDKTFGMLMEGLKQRN
LDNCVNIILLADHGMDKTYCDKMEYMTNYFHRINFYMYEGPAPRIRSRNIPQDFYTFNSE
EIVRNLSCRKPDQHFKPYLTPDLPKRLHFAKNVRIDKVHLLVDRQWLAVRSKAYSSCGGG
NHGYNNEFKSMEAIFLAHGPSFKEKTEIEPFENIEVYNLICETDLLHIQPAPNNGTHGSL
NHLLKVPFYEPSHAEEVSKFSVCGFTVPLPVDTLHCSCPVLQSNAALEHVNLMLNLSQNE
ITATEKLNVPFGRPRVMQKNKEHCLLYHREYVSGFGKAIRMPMWSSYTVLKPGDTSPLPP
TVPDCLRADVRVAPSESQNCSFYLADENITHGFLYPPANNRTSDSQYDALITSNLVPMYK
AFKKMWDYFHSVLLVKHAMERNGVNVVSGPVFDYNYDGHFDAPNEITEYIKNTSVPIPTH
YFVVLSSCKNKSHTPNACPGWLDVLPFIIPHRPTNVESCPENKPEAVWIEERWKAHIARV
RDVELLTGLDFYQEKVQPVSEILQLKTYLPTFETVI
Download sequence
Identical sequences ENSFCAP00000013106

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]