SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSFCAP00000013189 from Felis catus 76_6.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFCAP00000013189
Domain Number 1 Region: 377-629
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 9.98e-70
Family Protein kinases, catalytic subunit 0.000000000288
Further Details:      
 
Domain Number 2 Region: 149-261
Classification Level Classification E-value
Superfamily SH2 domain 2.69e-31
Family SH2 domain 0.000000635
Further Details:      
 
Domain Number 3 Region: 11-137
Classification Level Classification E-value
Superfamily SH2 domain 6.73e-31
Family SH2 domain 0.000000218
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFCAP00000013189   Gene: ENSFCAG00000014214   Transcript: ENSFCAT00000014219
Sequence length 637
Comment pep:known_by_projection chromosome:Felis_catus_6.2:D4:3852397:3900537:1 gene:ENSFCAG00000014214 transcript:ENSFCAT00000014219 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAGGVAADNANHLPFFFGNITREEAEDYLVQGGMSDGLYLLRQSRNYLGGFALSVAHGRK
AHHYTIERELNGTYAIAGGRAHGSPAELCHYHSQECDGLVCLLKKPFHRPPGVQPKTGPF
EDLKESLIREYVRQTWNLQQGQALEQAIISQKPQLEKLIATTAHEKMPWFHGKISRVESE
QIVLIGSKTNGKFLIRDRNDNGSYALCLLHEGKVLHYRIDKDKTGKLSIPDGKKFDTLWQ
LVEHYSYKADGLLRVLTVPCQKIGGQTGNINFGARAPLPGPHPATWSAGGIISRIKSYSF
PKPGHRKASTSQGSRPESAVTFNPYEPDRGPWPTDRDAQREALPMDTEVYESPYADPEEI
RPKEVYLDRKLLTLEDNELGSGNFGTVKKGYYQMKKVVKTVAVKILKNEANDPALKDELL
AEANVMQQLDNPYIVRMIGICEAESWMLVMEMAELGPLNKYLQQNRHVKDKNIIELVHQV
SMGMKYLEESNFVHRDLAARNVLLVTQHYAKISDFGLSKALRADENYYKAQTHGKWPVKW
YAPECINYYKFSSKSDVWSFGVLMWEAFSYGQKPYRGMKGSEVSAMLEKGERMGCPTGCP
REMYELMKLCWTYEVESRPGFAAVELRLRNYYYDVVN
Download sequence
Identical sequences ENSFCAP00000013189

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]