SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSFCAP00000013192 from Felis catus 76_6.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFCAP00000013192
Domain Number 1 Region: 194-246
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.95e-17
Family Classic zinc finger, C2H2 0.017
Further Details:      
 
Domain Number 2 Region: 169-203
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000215
Family Classic zinc finger, C2H2 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFCAP00000013192   Gene: ENSFCAG00000014220   Transcript: ENSFCAT00000014222
Sequence length 276
Comment pep:known_by_projection chromosome:Felis_catus_6.2:F2:44524943:44528408:1 gene:ENSFCAG00000014220 transcript:ENSFCAT00000014222 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGSKALPAPIPLHPSLQLTNYSFLQAVNTFPAAVDHLQGLYGLSAVQTMHMNHWTLGYPN
VHEITRSTITEMAAAQGLVDARFPFPALPFTTHLFHPKQGAIAHVLPALHKDRPRFDFAN
LAVAATQEDPPKMGDLTKLSPGLGSPISGLSKLTPDRKPSRGRLPSKTKKEFICKFCGRH
FTKSYNLLIHERTHTDERPYTCDICHKAFRRQDHLRDHRYIHSKEKPFKCQECGKGFCQS
RTLAVHKTLHMQTSSPTAASGAAKCSGETVICGGTA
Download sequence
Identical sequences XP_004000065.1.62641 XP_007073363.1.5354 XP_019323566.1.44245 ENSFCAP00000013192

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]