SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSFCAP00000013215 from Felis catus 76_6.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFCAP00000013215
Domain Number 1 Region: 586-774
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 6.02e-54
Family DBL homology domain (DH-domain) 0.00000000737
Further Details:      
 
Domain Number 2 Region: 779-919
Classification Level Classification E-value
Superfamily PH domain-like 3.92e-38
Family Pleckstrin-homology domain (PH domain) 0.00000017
Further Details:      
 
Domain Number 3 Region: 278-415
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000000183
Family Spectrin repeat 0.004
Further Details:      
 
Domain Number 4 Region: 1074-1130
Classification Level Classification E-value
Superfamily SH3-domain 0.0000000174
Family SH3-domain 0.0014
Further Details:      
 
Domain Number 5 Region: 32-184
Classification Level Classification E-value
Superfamily CRAL/TRIO domain 0.0000183
Family CRAL/TRIO domain 0.0085
Further Details:      
 
Weak hits

Sequence:  ENSFCAP00000013215
Domain Number - Region: 425-516
Classification Level Classification E-value
Superfamily Spectrin repeat 0.036
Family Spectrin repeat 0.0099
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFCAP00000013215   Gene: ENSFCAG00000014242   Transcript: ENSFCAT00000014246
Sequence length 1167
Comment pep:known_by_projection chromosome:Felis_catus_6.2:A1:81017260:81070892:1 gene:ENSFCAG00000014242 transcript:ENSFCAT00000014246 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RCASLGLQRLNLSTGGTDEIMHQDITPLCAADIQDQLKKRFAYLSGGRGQDGSPVITFPD
YPAFSDVPDKEFQNVMTYLTSIPSLQDAGIGFILVIDRRQDKWTSVKASVLRIAASFPAN
LQLVLVLRPAGFFQRTLSDLAFKFNRDDFKMKVPVIMLSSVPELHGYIDKSQLTEDLGGT
LDYCHTRWLCHRTAIESFALMVKQTAQMLQSFGTELAETELPNDVQSTSSVLCAHTEKKD
KAKEDMRAALDEGQSLLQSVREPLAKGGGRSLSQDQLDNQTTVQRLLAQLNETEAAFDEF
WAKHQQKLQQCLQLRHFEQDFREVKASLDALAQKIATFTDVGNSLAHAGHLLKDLTSFEE
KSSVSVERALALALEGEKLIDSRHYAVDSIRPKCHELQHLCNQFAAEVERRRELLSKSLE
LHSLLEASMKWCDEGIYLLASQPVDKCQSQEGAEAALQEIEKFLETGAENKIQELDRIYQ
DYESVLTTDLMEHVQKVYQKQEGTEEMFHRRQASLKKLAAKQTRPVQPVAPRPEALTKSP
CPSPGSRRGSENSPEGSMLRRGPYRRAKSEVTESRQGRGSSTGDEEESLAILRRHVMNEL
LDTERVYVEELLCVLEGYAAELDNPLMAHLVSPGLQNKKDILFGNMEEIYHFHNRIFLRE
LENYTDCPELVGRCFLERMEEFQIYEKYCQNKPRSESLWRQCSDCPFFQECQRKLDHKLS
LDSYLLKPVQRITKYQLLLKEMLKYSKSCEGAEDLQEALSSILGILKAVNDSMHLIAITG
YDGNLSDLGRLLMQGSFSVWTDHKKGHTKVKDLARFKPMQRHLFLHEKAVLFCKKREENG
EGYEKAPSYSYKQSLNMAAVGITENVKGDVRKFEIWYNAREEVYIIQAPTVEIKAAWVSE
IRKVLTSQLQACREASQHRALEQSQSLPLPTPPSTSPSKGNTRNIKKLEERKTDPLSLEG
YVSSTPLPKPPEKGRGDDTAPSSTSESSALSKTRFALPGLAALTGQKASPTSPGKKAKRH
EVKSDPTPFGLRGWSKTSHPSEAPEDDGWSSAEELINSSDAEEEGRVGPRKLVPGKYTVV
LGDEKESPEALAVRSGDVVEVVQEGDEGLWYVRNLTSSKESWVPASSLSTLLGTSGSAQC
LSSSGKTPVPCWLRFEPAGSAASSSGV
Download sequence
Identical sequences ENSFCAP00000013215

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]