SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSFCAP00000013248 from Felis catus 76_6.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFCAP00000013248
Domain Number 1 Region: 8-164
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 1.03e-39
Family Dual specificity phosphatase-like 0.0000001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFCAP00000013248   Gene: ENSFCAG00000014279   Transcript: ENSFCAT00000014282
Sequence length 173
Comment pep:known_by_projection chromosome:Felis_catus_6.2:F2:80200265:80205949:1 gene:ENSFCAG00000014279 transcript:ENSFCAT00000014282 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MARMNRPAPVEVSYKRMRFLITHNPTNATLSTFIEDLKKYGATTVVRVCEVTYDKAPLEK
DGITVVDWPFDDGAPPPGKVVEDWLSLLKAKFCDDPGSCVAVHCVAGLGRAPVLVALALI
ESGMKYEDAIQFIRQKRRGAINSKQLTYLEKYRPKQRLRFKEPHAHKTKCCVM
Download sequence
Identical sequences A0A2I2UKX7
XP_004000199.1.62641 XP_011289777.1.62641 XP_019678763.1.62641 ENSFCAP00000013248

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]