SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSFCAP00000013265 from Felis catus 76_6.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFCAP00000013265
Domain Number 1 Region: 617-817
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 4.45e-37
Family DBL homology domain (DH-domain) 0.00000523
Further Details:      
 
Domain Number 2 Region: 830-957
Classification Level Classification E-value
Superfamily PH domain-like 2.24e-26
Family Pleckstrin-homology domain (PH domain) 0.00026
Further Details:      
 
Domain Number 3 Region: 320-416
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000000000116
Family Spectrin repeat 0.0047
Further Details:      
 
Domain Number 4 Region: 43-194
Classification Level Classification E-value
Superfamily CRAL/TRIO domain 0.00000719
Family CRAL/TRIO domain 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFCAP00000013265   Gene: ENSFCAG00000014298   Transcript: ENSFCAT00000014302
Sequence length 1115
Comment pep:known_by_projection chromosome:Felis_catus_6.2:C2:86294832:86521507:1 gene:ENSFCAG00000014298 transcript:ENSFCAT00000014302 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLFVFKMSCRPKGVGRYLSTCLDNETIHEIMQQEIRPLVAVDIIEQLHRQFAILSGGRGK
DGAPIITFPEFVGFKHIPEEDFLNVMTYLTSIPSVEAASIGFVIVIDRRRDKWSSIKASL
TRIAVAFPGNLQLIFILRPSRFIQRTFTDIGIKYYRDEFKMKVPIIMLNSVSDLHGYIDK
SQLTEDLGGTLEYRHSQWINHRTAIENFAVTLKTTAQMLQMFGACLATTELPRGVLSTED
LLMSHTGQRDKLQDELKLLGKQGATLLSCIQEPATKSPTRKLNPNQLENVATMERLLLQL
DETEKAFNQFWSEHHLKLSQCLQLQHFEHNFHEVKRALDNLLAEQAEFTDIGDSVIRVEQ
LLKEHKKLEEKGQEPLEKAQLLAVIGDQLIQSHHYAADSIRPRCVELRHLCDDFINENKK
YDILEKSLELHRQLDKVSQWCEAGIYLLASQAVDKCQSREGVDVALNDIEAFLGTAKEYH
LPSHMEFYSQFELILTLDLKAKAQEVLQKLGDVQEIFHKRQMSLMKLAARQTRPVQPVAP
HPESSPKWVSSKTSQPSTLVFLAPLQRTSEEPCTGTVEKDDKTKLEVKNEEILESSPDGA
NPEPEQLDGPAHLSPSRRIIRDLLETEEIYIKEIKSIIDGYITPMDFIWLKHLIPDVLQN
NKELLFGNIRELYEFHNRTFLKELEKCTENPALLARCFLKRKEDLQMYFKYHKNLPRARA
IWQECQDCAFFGVCQRQLDHNIPLFKYLRGPSQRLLKYQMLLKGLLDFETPKDWEIDPGD
QEGGSAKNGPKRTKDSAFLAELQQALAMMEDLIKSCELAVDLAAVTGCPDDIRKLGKLLM
HGSFSVWTVHKDRYKMKDFIRFKPSQRQIYLFERGIVFCKIRMEPSDQGLSPHYSFKKSM
KLKTLSVRQLGRGSSRKFEVANRNGLEKYILQATSKEIRDCWFSEISKLLMEQQNNIKGA
PYPHLCLSTQKGNGMGFVPWIENMETATSRKKSHTVVPGGLQGCSSKEFTSMETFDHPEG
AEDMEKENSALSLSGLFQLDDSYETCSSKSVLETGESVQGKKESGDEDNFRPTNTTKESA
AVPAALLGPAGDATSFRAKAERAREGCLRTPSPEN
Download sequence
Identical sequences ENSFCAP00000013265

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]