SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSFCAP00000013366 from Felis catus 76_6.2

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSFCAP00000013366
Domain Number - Region: 156-184
Classification Level Classification E-value
Superfamily RNA polymerase subunit RPB10 0.0131
Family RNA polymerase subunit RPB10 0.0078
Further Details:      
 
Domain Number - Region: 48-109
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0446
Family Spectrin repeat 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFCAP00000013366   Gene: ENSFCAG00000014409   Transcript: ENSFCAT00000014413
Sequence length 229
Comment pep:known_by_projection chromosome:Felis_catus_6.2:F1:19916584:19927187:1 gene:ENSFCAG00000014409 transcript:ENSFCAT00000014413 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSAKRAELKKSNLSKNYKAMCLELKPEPTKTYDYKGIKQEGLFTKPGGTQELRTELREVK
EELKEKMDEIKQIKGIMDKDFDKLQEFVEIMKEMQKDMDEKMDVLINMHKSSNPLRRGPE
EQQEFRLTAKMDTDPQLQLKKVDGADGMPLTLHEKMMALQKPEKDPLDSLHQGRTCCERC
LLCAQKNNCSQGRPIPSESLGLHKGGGEPVTFTCSHLCPAPNPLQTKTK
Download sequence
Identical sequences ENSFCAP00000013366

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]