SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSFCAP00000013374 from Felis catus 76_6.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFCAP00000013374
Domain Number 1 Region: 418-697
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 3.14e-78
Family Protein kinases, catalytic subunit 0.0000000409
Further Details:      
 
Domain Number 2 Region: 864-1006
Classification Level Classification E-value
Superfamily FAT domain of focal adhesion kinase 1.57e-57
Family FAT domain of focal adhesion kinase 0.00000741
Further Details:      
 
Domain Number 3 Region: 138-256
Classification Level Classification E-value
Superfamily Second domain of FERM 8.11e-42
Family Second domain of FERM 0.000021
Further Details:      
 
Domain Number 4 Region: 37-137
Classification Level Classification E-value
Superfamily Ubiquitin-like 3.72e-32
Family First domain of FERM 0.00048
Further Details:      
 
Domain Number 5 Region: 261-366
Classification Level Classification E-value
Superfamily PH domain-like 1.48e-30
Family Third domain of FERM 0.00015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFCAP00000013374   Gene: ENSFCAG00000014420   Transcript: ENSFCAT00000014424
Sequence length 1009
Comment pep:known_by_projection chromosome:Felis_catus_6.2:B1:49811074:49871859:1 gene:ENSFCAG00000014420 transcript:ENSFCAT00000014424 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSGVSEPLSRVKVGTLRRPEGPPEPMVVVPVDVEKEDVRILKVCFYSNSFNTGKNFKLVK
CTVQTEIQEVIASILLSGRIGPNIQLGECYGLRLKHMKSDEIHWLHPQMTVGEVQEKYEC
LHMEAEWRYDLQIRYLPEDFMESLKEDRTTLLYFYQQLRNDYMQRYASKVSEGMALQLGC
LELRRFFKDMPHNALDKKSNFEFLEKEVGLDLFFPKQMQENLKPKQFRKMIQQTFQQYAS
LREEECVMKFFNTLAGFANIDQETYRCELIQGWNITVDLVIGPKGIRQLTSQDAKPTCLA
EFKQIKSIRCLPLEEGQAVLQLGIEGAPQSLSIKTSSLAEAENMADLVDGYCRLQGEHKG
SLIIHPKKDGEKRNSLPQIPVLNLEAQRPHLSESCSIESDIYAEIPDETLRRPGGPQYGV
TRDDVVLNRILGEGFFGEVYEGVYTNHKGEKINVAVKTCKKDCTLDNKEKFLSEAVIMKN
LDHPHIVKLIGIIEEEPTWIIMELYPYGELGHYLERNKNSLKVLTLVLYSLQICKAMAYL
ESINCVHRDIAVRNILVASPECVKLGDFGLSRYIEDEEYYKASVTRLPIKWMSPESINFR
RFTTASDVWMFAVCMWEILSFGKQPFFWLENKDVIGVLEKGDRLPKPDLCPPVLYTLMTR
CWDYDPSERPRFTELVCNLSDIYQMEKDIAIEQERNARYRPPKILEPTAYQEPPPKPSRP
KYRPPPQTNLLAPKLQFQVPEGLCASSPTLTSPMEYPSPVNSLHTPPLHRHNVFKRHSMR
EEDFIRPSSREEAQQLWEAERLKMRQILEKQQKQMVEDYQWLRQEEKSLTPMVYMNDKSP
LVSHREKVLPEFTGPPQKPPRLGAQSIQPTANLDRTDDLVYLNVMELVRAVLDLKNELCQ
LPPEGYVVVVKNVGLTLRKLIGSVDDLLPSLPSSSRTEIEGTQKLLNKDLAELINKMRLA
QQNAVTSLSEECKRQMLTASHTLAVDAKNLLDAVDQAKVLANLAHPPAE
Download sequence
Identical sequences ENSFCAP00000013374

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]