SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSFCAP00000013401 from Felis catus 76_6.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFCAP00000013401
Domain Number 1 Region: 85-840
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 8.5e-280
Family Motor proteins 0.000000000112
Further Details:      
 
Domain Number 2 Region: 2047-2163
Classification Level Classification E-value
Superfamily Second domain of FERM 1.14e-22
Family Second domain of FERM 0.0024
Further Details:      
 
Domain Number 3 Region: 1296-1399
Classification Level Classification E-value
Superfamily Ubiquitin-like 1.17e-20
Family First domain of FERM 0.033
Further Details:      
 
Domain Number 4 Region: 2164-2254
Classification Level Classification E-value
Superfamily PH domain-like 2.46e-20
Family Third domain of FERM 0.015
Further Details:      
 
Domain Number 5 Region: 1947-2055
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.00000000000000111
Family First domain of FERM 0.088
Further Details:      
 
Domain Number 6 Region: 1391-1485
Classification Level Classification E-value
Superfamily Second domain of FERM 0.000000000000209
Family Second domain of FERM 0.0076
Further Details:      
 
Domain Number 7 Region: 1650-1719
Classification Level Classification E-value
Superfamily SH3-domain 0.0000000228
Family SH3-domain 0.0042
Further Details:      
 
Weak hits

Sequence:  ENSFCAP00000013401
Domain Number - Region: 839-907
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.00023
Family Motor proteins 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFCAP00000013401   Gene: ENSFCAG00000014446   Transcript: ENSFCAT00000014451
Sequence length 2268
Comment pep:known_by_projection chromosome:Felis_catus_6.2:D1:57510972:57580924:-1 gene:ENSFCAG00000014446 transcript:ENSFCAT00000014451 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEPPADPAEPSDPADPADPSDRAEARAKPQGKWALVRSLNHALKTYAVLPGDYVWMDLRS
GQEFDVPIGAVVKLCDSGQIQVVDDEGNEHWISPQNATHIKPMHPTSVHGVEDMIRLGDL
NEAGILRNLLIRYRDHLIYTYTGSILVAVNPYQLLSIYSPEHIRQYTNKKIGEMPPHIFA
IADNCYFNMKRNSRDQCCIISGESGAGKTESTKLILQFLAAISGQHSWIEQQVLEATPIL
EAFGNAKTIRNDNSSRFGKYIDIHFNKRGAIEGAKIEQYLLEKSRVCRQAPDERNYHVFY
CMLEGMSADQKKRLGLGQATDYNYLAMGNCITCEGREDSQEYANIRSAMKVLMFTDTENW
EISKLLASILHLGNLQYEARTFENLDACEVLFSPSLTTAASLLEVNPPDLMNCLTSRTLI
TRGETVSTPLSREQALDVRDAFVKGIYGRLFVWIVDKINAAIYKPPSQEVKSSRRSIGLL
DIFGFENFAVNSFEQLCINFANEHLQQFFVRHVFKLEQEEYDLESIDWLHIEFTDNQDAL
DMIANKPMNIISLIDEESKFPKGTDTTMLHKLNSQHKLNSNYIPPKNNHETQFGINHFAG
VVYYESQGFLEKNRDTLHGDIIQLVHSSRNKFIKQIFQADVAMGAETRKRSPTLSSQFKR
SLELLMRTLGACQPFFVRCIKPNEFKKPMLFDRHLCVRQLRYSGMMETIRIRRAGYPIRY
SFVEFVERYRVLLPGVKPAYKQDDLRGTCQRMAEAVLGTHDDWQIGKTKIFLKDHHDMLL
EVERDKAITDRVILLQKVIRGFKDRSNFLKLKNAATLIQRHWRGHNCRRNYELMRLGFLR
LQALHRSRKLHQKYRLARRRIIGFQARCRAYLVRKAFRHRLWAVLTVQAYARGMIARRLH
RRLRAEYLRRLEAEKMRLAEEEKLRKEMSAKKAKEEAERKHQERLAQLAREDAERELKEK
EEARRKKELLEQMERARHEPINHSDMVDKMFGFLGTSGGLPGQEGQAPSGFEDLERGRRE
MVEEDLDAALPLPDEDEEDLSEYKFAKFAATYFQGTTTHTYTRRPLRQPLLYHDDEGDQL
AALAVWITILRFMGDLPEPKYHTAMSDGSEKIPVMTKIYETLGKKTYKRELQALQGEGEA
QLPEGQKKSSMRHKLVHLTLKKKSKLTEEVTKRLHDGESTVQGNSMLEDRPTSNLEKLHF
IIGNGILRPALRDEIYCQISKQLTHNPSKSSYARGWILVSLCVGCFAPSEKFVKYLRNFI
HGGPPGYAPYCEERLRRTFVNGTRTQPPSWLELQATKSKKPIMLPVTFMDGTTKTLLTDS
ATTAKELCNALADKISLKDRFGFSLYIALFDKVSSLGSGSDHVMDAISQCEQYAKEQGAQ
ERNAPWRLFFRKEVFTPWHNPSEDNVATNLIYQQVVRGVKFGEYRCEKEDDLAELASQQY
FVDYGSEMILERLLNLVPTYIPDREITPLKTLEKWAQLAIAAHKKGIYAQRRTDAQKVKE
DVVNYARFKWPLLFSRFYEAYKFSGPNLPKNDVIVAVNWTGVYFVDEQEQVLLELSFPEI
MAVSSSRECRVLLSLGCSDLGCAAPHSGWAGLTPAGPCSPCWSCRGAKLVAPSFTLATIK
GDEYTFTSSNAEDIRDLVVTFLEGLRKRSKYVVALQDNPNPAGEESGFLSFAKGDLIILD
HDTGEQVMNSGWANGINERTKQRGDFPTDCVYVMPTVTLPPREIVALVTMTPDQRQDVIR
LLQLRTAEPEVRAKPYTLEEFSYDYFSDLCGGMPQAAHAKARAEKAEARGKDRLWSHTRE
PLKQALLKKILGSEELSQEACMAFIGSPPMLKYMGDYPSKRTRSVNELTDQIFEGALKAE
ALKDEVYVQILKQLTDNHIRYSEERGWELLWLCTGLFPPSNILLPHVQRFLQSRKHCPLA
IDCLQRLQKALRNGSRKYPPHLVEVEAIQHKTTQIFHKVYFPDDTDEAFEVESSTKAKDF
CQNIAARLLLKSSEGFSLFVKIADKVISVPENDFFFDFVRHLTDWIKKARPVKDGIVPSL
TYQVFFMKKLWTTTVPGKDPMADSIFHYYQELPKYLRGYHKCTREEVLQLGALIYRVKFE
EDKSYFPSIPKLLRELVPQDLIRQVSPDDWKRSIVAYFNKHAGKSKEEAKLAFLKLIFKW
PTFGSAFFEVKQTTEPNFPEILLIAINKYGVSLIDPRTKDILTTHPFTKISNWSSGNTYF
HITIGNLVRGSKLLCETSLGYKMDDLLTSYISQMLTAMSKQRGSRSGK
Download sequence
Identical sequences ENSFCAP00000013401

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]