SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSFCAP00000013411 from Felis catus 76_6.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFCAP00000013411
Domain Number 1 Region: 3-141
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 4.76e-41
Family Dual specificity phosphatase-like 0.00039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFCAP00000013411   Gene: ENSFCAG00000014458   Transcript: ENSFCAT00000014462
Sequence length 184
Comment pep:known_by_projection chromosome:Felis_catus_6.2:B2:28479605:28541761:-1 gene:ENSFCAG00000014458 transcript:ENSFCAT00000014462 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGNGMNKILPGLYIGNFKDARDAEQLSKNKVTHILSVHDSARPMLEGVKYLCIPAADSPS
QNLTRHFKESIKFIHECRLRGEGCLVHCLAGVSRSVTLVIAYIMTVTDFGWEDALHTVRA
GRSCANPNLGFQRQLQEFEKHEVHQYRQWLKEEYGESPLRDAEEAKNILATPRILKYWAF
LRRL
Download sequence
Identical sequences A0A2I2V2I3
XP_003985911.1.62641 ENSFCAP00000013411

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]