SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSFCAP00000013471 from Felis catus 76_6.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFCAP00000013471
Domain Number 1 Region: 759-821
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.00000353
Family Ubiquitin-related 0.031
Further Details:      
 
Weak hits

Sequence:  ENSFCAP00000013471
Domain Number - Region: 4-16,235-242
Classification Level Classification E-value
Superfamily Formin homology 2 domain (FH2 domain) 0.00034
Family Formin homology 2 domain (FH2 domain) 0.057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFCAP00000013471   Gene: ENSFCAG00000014522   Transcript: ENSFCAT00000014526
Sequence length 1223
Comment pep:known_by_projection chromosome:Felis_catus_6.2:F2:16760777:16785218:-1 gene:ENSFCAG00000014522 transcript:ENSFCAT00000014526 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSQPPPPPPLPPPPPPPEAPQTPPSLAAAAAAAPPGGLSKRRDRRILSGSCPDPKCQARL
FFPASGSVSIECTECGQRHEQQQLLGVEEVTDPDVVLHNLLRNALLGVTGAPKKNTELVK
VMGLSNYHCKLLSPILARYGMDKQTGRAKLLRDMNQGELFDCALLGDRAFLIEPEHVNTV
GYGKDRSGSLLYLHDTLEDIKRANKSQECLIPVHVDGDGHCLVHAVSRALVGRELFWHAL
RENLKQHFQQHLAQYQALFHDFIDAAEWEDIINECDPLFVPPEGVPLGLRNIHIFGLANV
LHRPIILLDSLSGMRSSGDYSATFLPGLIPAEKCTGRDGHLNKPICIAWSSSGRNHYIPL
VGIKGAALPKLPMNLLPKAWGVPQDLIKKYIKLEEDGGCVIGGDRSLQDKYLLRLVAAME
EVFMDKHGIHPSLVADVHQYFYRRTGVIGVQPEEVTAAAKKAVMDNRLHKCLLCGALSEL
HVPPEWLAPGGKLYNLAKSTHGQLRPDKNYSFPLNNLVCSYDSVKDVLVPDYGLSNLTAC
NWCHGTSVRRVRGDGSIVYLDGDRTNSRSTGGKCGCGFKHFWDGKEYDNLPEAFPITLEW
GGRVVRETVYWFQYESDSSLNSNVYDVAMKLVTKHFPGEFGSEILVQKVVHTILHQTAKK
NPDDYTPVNIDGAHAQRVGDVQGQESESQLPTKIILTGQKTKTLHKEELNMSKTERTIQQ
NITEQAAVMQKRKTEKLKQEQKGQPRTVSPSTIRDGPSSAPATPTKAPYSPTTSKEKKIR
ITTNDGRQSMVTLKSSTTFFELQESIAREFNIPPYLQCIRYGFPPKELMPPQAGMEKEPV
PLQHGDRITIEILKSKAEGGQSAAAHSAHTVKQEEVAVTGKLSKELQEQADKEMYSLCLL
ATLMGEDVWSYAKGLPHMFQQGGVFYNIMKKTMGMADGKHCTFPHLPGKTFVYNASEDRL
ELCVDAAGHFPIGPDVEDLVKEAVSQVRAEATTRSRESSPSHGLLKLGSGGVVKKKSEQL
HNVTAFQGKGHSLGTASSNPHLDSRAREAPVVRKHNTGTDFSTSSIKIEPSVFTAAPSNS
ELIRIAPGVVTMRDSRQLDPDLVEAQRKKLQEMVSSIQASMDKHLRDQSTEQPPSDLPQR
KAEVVSSSVKSGSLQTGLPESFSLTGGTENLNIETTDSCVAEALGAAFATRSKAQKGNSV
EEPEEMDSQDAEMTNTTEPMDHS
Download sequence
Identical sequences M3WKV0
XP_003999910.1.62641 ENSFCAP00000013471

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]