SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSFCAP00000013560 from Felis catus 76_6.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFCAP00000013560
Domain Number 1 Region: 453-743
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 2.83e-82
Family Protein kinases, catalytic subunit 0.000000000131
Further Details:      
 
Domain Number 2 Region: 955-1092
Classification Level Classification E-value
Superfamily FAT domain of focal adhesion kinase 1.44e-57
Family FAT domain of focal adhesion kinase 0.00000028
Further Details:      
 
Domain Number 3 Region: 176-297
Classification Level Classification E-value
Superfamily Second domain of FERM 1.29e-39
Family Second domain of FERM 0.0000005
Further Details:      
 
Domain Number 4 Region: 75-174
Classification Level Classification E-value
Superfamily Ubiquitin-like 1.65e-39
Family First domain of FERM 0.00000228
Further Details:      
 
Domain Number 5 Region: 298-406
Classification Level Classification E-value
Superfamily PH domain-like 1.72e-36
Family Third domain of FERM 0.00000136
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFCAP00000013560   Gene: ENSFCAG00000014619   Transcript: ENSFCAT00000014623
Sequence length 1099
Comment pep:known_by_projection chromosome:Felis_catus_6.2:F2:79616419:79814839:-1 gene:ENSFCAG00000014619 transcript:ENSFCAT00000014623 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLVELAGREALRPAGAVCMEKSGCGPFPMCWAKDYDRYIAPSKIMAAAYLDPNLNHTPNS
STKTHLGTGVERSPGAMERVLKVFHYFENSSEPATWASIIRHGDATDVRGIIQKIVDSHK
VKHVACYGFRLSHLRSEEVHWLHLDMGVSNVREKYELAHPPEEWKYELRIRYLPKGFLNQ
FTEDKPTLNFFYQQVKSDYMSEIADRVDQDIALKLGCLEIRRSYWEMRGNALEKKSNYEV
LEKDVGLKRFFPRSLLDSVKAKTLRKLIQQTFRQFANLNREESILKFFEILSPVYRFDKE
CFKCALGSSWIISVELAIGPEEGISYLTDKGCSPTHLADFNQVQTIQYSNSEDKDRKGTL
QLKIAGAPEPLTVTAPSLTIAENMADLIDGYCRLVNGATQSFIIRPQKEGERALPSIPKL
ANSEKQGVRTHAVSVSETDDYAEIIDEEDTYTMPSTRDYEIQRERIELGRCIGEGQFGDV
HQGVYMSPENPALAVAIKTCKNCTSDSVREKFLQEALTMRQFDHPHIVKLVGVITENPVW
IIMELCTLGELRSFLQVRKYSLDLASLILYAYQLSTALAYLESKRFVHRDIAARNVLVSS
NDCVKLGDFGLSRYMEDSTYYKASKGKLPIKWMAPESINFRRFTSASDVWMFGVCMWEIL
MHGVKPFQGVKNNDVIGRIENGERLPMPPNCPPTLYSLMTKCWAYDPSRRPRFTELKAQL
STILEEEKVQQEERMRMESRRQVTVSWDSGGSDEAPPKPSRPGYPSPRSSEGFYPSPQHM
VQTNHYQVSGYPGSHGVTATAGSIYPGQASLLDQTDSWNHRPQEISMWQPNVEDSAALDL
RGIGQVLPTQLVEERLIRQQQEMEEDQRWLEKEERFLVILKPDVRLSRGSIDREDGSLQG
PTGNQHIYQPVGKPDPAAPPKKPPRPGAPGHLGSLASLSSPGDSYNEGVKLQPQEISPPP
TANLDRSNDRVYENVTGLVKAVIEMSSKIQPAPPEEYVPMVKEVGLALRTLLATVDETLP
VLPASTHREIEMAQKLLNSDLGELINKMKLAQRCAMTSLQQDHKKQMLTAAHALAVDAKN
LLDVIDQARLRALGHARPR
Download sequence
Identical sequences M3WL08
XP_006943487.1.62641 ENSFCAP00000013560

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]