SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSFCAP00000013564 from Felis catus 76_6.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFCAP00000013564
Domain Number 1 Region: 349-513
Classification Level Classification E-value
Superfamily PH domain-like 3.32e-58
Family Phosphotyrosine-binding domain (PTB) 0.0000000466
Further Details:      
 
Domain Number 2 Region: 527-650
Classification Level Classification E-value
Superfamily PDZ domain-like 1.71e-21
Family PDZ domain 0.0000304
Further Details:      
 
Domain Number 3 Region: 642-726
Classification Level Classification E-value
Superfamily PDZ domain-like 3.55e-16
Family PDZ domain 0.0000181
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFCAP00000013564   Gene: ENSFCAG00000014623   Transcript: ENSFCAT00000014627
Sequence length 733
Comment pep:known_by_projection chromosome:Felis_catus_6.2:D4:11949088:12015678:-1 gene:ENSFCAG00000014623 transcript:ENSFCAT00000014627 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNHLEGSAEAEVTDEAAGGEVNESVEADLEHPEVEEQQQRYAGRPGRGRAVEDPRAPPGQ
QEEEERGECLARSASTESGFHNHTDTAEGDVIAAARDGYDAERAQDPEDESAYAVQYRPE
AEEYTEQAEAEHAEATHRRALPNHLHFHSLEHEEAMNAAYSGYVYTHRLFHRGEDEPYAE
PYADYGGLQEHVYEEIGDAPELEARDGLRLYEQERLAGQQRAAGTAGGEAGQRYSKEKRD
AISLAIKDIKEAIEEVKTRTIRSPYTPDEPKEPIWVMRQDISPTRDCDDQRPVDGDSPSP
GSSPPLGAESSSIPLHPSDPAEASSNKESRKSLASFPTYVEVPGPCDPEDLIDGIIFAAN
YLGSTQLLSDKTPSKNVRMMQAQEAVSRIKMAQKLAKSRKKAPEGESQPMTEVDLFISTQ
RIKVLNADTQETMMDHPLRTISYIADIGNIVVLMARRRMPRSNSQENVEASHPSQDGKRQ
YKMICHVFESEDAQLIAQSIGQAFSVAYQEFLRANGINPEDLSQKEYSDLLNTQDMYNDD
LIHFSKSENCKDVFIEKQKGEILGVVIVESGWGSILPTVIIANMMHGGPAEKSGKLNIGD
QIMSINGTSLVGLPLSTCQSIIKGLKNQPRVKLNIVRCPPVTTVLIRRPDLRYQLGFSVQ
NGIICSLMRGGIAERGGVRVGHRIIEINGQSVVATPHEKIVHILSNAVGEIHMKTMPAAM
YRLLTAQEQPVYI
Download sequence
Identical sequences ENSFCAP00000013564

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]