SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSFCAP00000013734 from Felis catus 76_6.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFCAP00000013734
Domain Number 1 Region: 306-346
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.0000000000000137
Family TRASH domain 0.0033
Further Details:      
 
Weak hits

Sequence:  ENSFCAP00000013734
Domain Number - Region: 820-830
Classification Level Classification E-value
Superfamily Formin homology 2 domain (FH2 domain) 0.0968
Family Formin homology 2 domain (FH2 domain) 0.13
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFCAP00000013734   Gene: ENSFCAG00000014806   Transcript: ENSFCAT00000014810
Sequence length 1373
Comment pep:known_by_projection chromosome:Felis_catus_6.2:X:59012540:59026223:-1 gene:ENSFCAG00000014806 transcript:ENSFCAT00000014810 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDPSDFPSPFDPLTLPEKPLAGDLPVDMEFGEDLLESQTAPTRGWAPPGPSPSSGALDLL
DAPAGLEKDPGVLDGATELLGLGGLLYKAPSPPEVDHGPEGTLAWDAGDQTLEPGPGGQT
PEVVPPEPGAGANPSSPQGLLEPLAPDSPITLQPPHIEEEETTNIATGRRGSPGQEEELP
QGQPQSPNGPPSPSVGETLGDGINSSQTKPGGPSPPAHPSLPGDGLTGKASEKPPERVQK
RSERVRRVEPPKPEVVDSTESIPVSDEDSDAMVDDPNDEDFVPFRPRRSPRMSLRSSVAQ
RAGRSAVGTKMTCAHCRTPLQKGQTAYQRKGLPQLFCSSSCLTTFSKKPSGKKTCTFCKK
EIWNTKDSVVAQTGSGGSFHEFCTSVCLSLYEAQQQRPIPQSGDPADATRCSICQKTGEV
LHEVSNGSVVHRLCSDSCFSKFRANKGLKTNCCDQCGAYIYTKTGSPGPELLFHEGQQKR
FCNTTCLGAYKKKNTRVYPCVWCKTLCKNFEMLSHVDRNGKTSLFCTLCCTTSYKVKQAG
LTGPPRPCSFCRRSLSDPCYYNKVDRTVYQFCSPSCWTKFQRTSPEGGIHLSCHYCHSLF
SGKPEVLDWQDQVFQFCCRDCCEDFKRLRGVVSQCEHCRQEKLLHEKLRFSGVEKSFCSE
GCVLLYKQDFTKKLGLCCITCTYCSQTCQRGVTEQLDGSTWDFCSEDCKSKYLLWYCKAA
RCHACKRQGKLLETIHWRGQIRHFCNQQCLLRFYSQQNQPNLDTQSGPESLLNSQSPESK
PQAPSQTKVENSSTVKTPEENGNLGKIPAKTRSAPAASTPPPPPPPPATPRKNKAAMCKP
LMQNRGVSCKVEMKSKGSQTEEWKPQVIVLPIPVPIFVPVPMHLYCQKVPVPFSMPIPVP
VPMFLPTTLESTDKIVETIEELKVKIPSNPLEADILAMAEMIAEAEELDKASSDLCDLVS
NQSAEGLLEDCDLFGPARDDVLAMAVKMANVLDEPGQDLEADFPKNPLDINPSVDFLFDC
GLVGPEDVSTEQDLPRTMRKGQKRLVLSESCSRDSMSSQPSCTGLNYSYGVNAWKCWVQS
KYANGETSKGDELRFGPKPMRIKEDILACSAAELNYGLAQFVREITRPNGERYEPDSIYY
LCLGIQQYLLENNRMVNIFTDLYYLTFVQELNKSLSTWQPTLLPNNTVFSRVEEEHLWEC
KQLGVYSPFVLLNTLMFFNTKFFGLQTAEEHMQLSFTNVVRQSRKCTTPRGTTKVVSIRY
YAPVRQRKGRDTGPGKRKREEEAPILEQRENRMNPLRCPPSPHPPRHYYSPESLRTRNDV
FYLQPERSCIAESPLWYSVIPMDRSMLESMLNRILAVREIYEELGRPGEEDLD
Download sequence
Identical sequences ENSFCAP00000013734

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]