SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSFCAP00000013945 from Felis catus 76_6.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFCAP00000013945
Domain Number 1 Region: 57-117
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 3.09e-18
Family Erythroid transcription factor GATA-1 0.00043
Further Details:      
 
Domain Number 2 Region: 5-55
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 2.95e-16
Family Erythroid transcription factor GATA-1 0.00041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFCAP00000013945   Gene: ENSFCAG00000015036   Transcript: ENSFCAT00000015039
Sequence length 236
Comment pep:known_by_projection chromosome:Felis_catus_6.2:B1:53878039:53925030:1 gene:ENSFCAG00000015036 transcript:ENSFCAT00000015039 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFDDFSEGRECVNCGAMSTPLWRRDGTGHYLCNACGLYHKMNGINRPLIKPQRRLSASRR
VGLSCANCQTTTTTLWRRNAEGEPVCNACGLYMKLHGVPRPLAMRKEGIQTRKRKPKNLN
KSKTPAGPSGSESLPPATSASSNSSNAATSSSEEMRPIKTEPGLSAYHGHSSSMAQTFSV
SAMSGHGPSIHPVLSALKLSPQGYASSVSQSPQASSKQDPWNSLALADSHGDIITA
Download sequence
Identical sequences M3WLT5
XP_007097198.1.5354 XP_011279866.1.62641 XP_014928652.1.86478 XP_019296490.1.44245 XP_019296491.1.44245 XP_019684243.1.62641 ENSFCAP00000013945

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]