SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSFCAP00000014033 from Felis catus 76_6.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFCAP00000014033
Domain Number 1 Region: 288-425
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.12e-40
Family variant C2H2 finger 0.016
Further Details:      
 
Domain Number 2 Region: 212-280
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.98e-17
Family Classic zinc finger, C2H2 0.045
Further Details:      
 
Weak hits

Sequence:  ENSFCAP00000014033
Domain Number - Region: 167-202
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0179
Family variant C2H2 finger 0.063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFCAP00000014033   Gene: ENSFCAG00000015127   Transcript: ENSFCAT00000015132
Sequence length 450
Comment pep:known_by_projection chromosome:Felis_catus_6.2:A2:131178906:131289380:1 gene:ENSFCAG00000015127 transcript:ENSFCAT00000015132 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAPETQGAAARGEEDCKSNHSESGSVSYEDSKDCILEPLSLPESPGGTTALEGSPSVPC
IFCEEHFPMDEQDKLLKHMIIEHKMVIADVKLVADFQRYILYWRKRFTEQPVTDFCSVIR
INSTAPLEEQDNYFLLCDVLPEDRVLREELQKQRLKEILEQQQQERNDNNFHGICMFCNE
EFFGNRSVLLNHMAREHAFNIGLPDNIVNCNEFLCTLQKKLDNLQCLYCEKTFRDKNTLK
DHMRKKQHRRINPKNREYDRFYVINYLELGKSWEEVQLEDDRELLDHQEDDWSDWEERPD
SAVCLFCEKQAETIEKLCVHMEEAHDFDLLKIKSELGLNFYQQVKLVNFIRRQIHQCRCY
SCHVKFKSKAELRTHMEETKHTSLLPERKIWDQPEYYFPTYENDILLCTLSDSESDLTAQ
EQNGNITIISEDTSKLHALKQTSILNQLLL
Download sequence
Identical sequences ENSFCAP00000014033

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]