SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSFCAP00000014058 from Felis catus 76_6.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFCAP00000014058
Domain Number 1 Region: 11-110
Classification Level Classification E-value
Superfamily PX domain 5.1e-21
Family PX domain 0.0028
Further Details:      
 
Weak hits

Sequence:  ENSFCAP00000014058
Domain Number - Region: 112-206
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.00183
Family Ubiquitin-related 0.076
Further Details:      
 
Domain Number - Region: 211-254
Classification Level Classification E-value
Superfamily Second domain of FERM 0.0994
Family Second domain of FERM 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFCAP00000014058   Gene: ENSFCAG00000015154   Transcript: ENSFCAT00000015158
Sequence length 437
Comment pep:known_by_projection chromosome:Felis_catus_6.2:A3:120576503:120584860:-1 gene:ENSFCAG00000015154 transcript:ENSFCAT00000015158 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MHFSIPETESRSGDSGGSAYVAYNIHVNGVLHCRVRYSQLLGLHEQLRKEYGANVLPAFP
PKKLFSLTPAEVEQRREQLEKYMQAVRQDPLLGSSETFNSFLRRAQQETQQVPTEEVSLE
VLLSNGQKVLVNVLTSDQTEDVLEAVAAKLDLPDDLIGYFSLFLVREKEDGTFSFVRKLQ
EFELPYVSVTSLRSQEYKIVLRKSYWDSAYDDDVMENRVGLNLLYAQTVSDIERGWILVT
KEQHRQLKSLQEKVSKKEFLRLAQTLRHYGYLRFDACVADFPEKDCPVVVSAGNSELSLQ
LRLPGQQLREGSFRVTRMRCWRVTSSVPLPSGGTSSPGRGRGEVRLELAFEYLMSKDRLQ
WVTITSPQAIMMSICLQSMVDELMVKKSGGSIRKMLRRRVGGTLRRSDSQQAVKSPPLLE
SPDASRESMVKLSVSFP
Download sequence
Identical sequences ENSFCAP00000014058

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]