SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSFCAP00000014141 from Felis catus 76_6.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFCAP00000014141
Domain Number 1 Region: 3-225
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 4.66e-85
Family Calponin-homology domain, CH-domain 0.00000128
Further Details:      
 
Domain Number 2 Region: 1443-1666
Classification Level Classification E-value
Superfamily Plakin repeat 2.22e-53
Family Plakin repeat 0.000079
Further Details:      
 
Domain Number 3 Region: 1670-1848
Classification Level Classification E-value
Superfamily Plakin repeat 9.29e-48
Family Plakin repeat 0.00038
Further Details:      
 
Domain Number 4 Region: 2301-2507
Classification Level Classification E-value
Superfamily Plakin repeat 9.59e-45
Family Plakin repeat 0.00018
Further Details:      
 
Domain Number 5 Region: 6095-6253
Classification Level Classification E-value
Superfamily Spectrin repeat 4.98e-31
Family Spectrin repeat 0.0017
Further Details:      
 
Domain Number 6 Region: 6534-6692
Classification Level Classification E-value
Superfamily Spectrin repeat 8.23e-29
Family Spectrin repeat 0.0023
Further Details:      
 
Domain Number 7 Region: 5215-5375
Classification Level Classification E-value
Superfamily Spectrin repeat 1.23e-28
Family Spectrin repeat 0.0047
Further Details:      
 
Domain Number 8 Region: 2592-2695
Classification Level Classification E-value
Superfamily Plakin repeat 3.4e-24
Family Plakin repeat 0.0013
Further Details:      
 
Domain Number 9 Region: 241-357
Classification Level Classification E-value
Superfamily Spectrin repeat 7.33e-24
Family Spectrin repeat 0.0082
Further Details:      
 
Domain Number 10 Region: 5326-5471
Classification Level Classification E-value
Superfamily Spectrin repeat 1.32e-23
Family Spectrin repeat 0.0022
Further Details:      
 
Domain Number 11 Region: 7047-7123
Classification Level Classification E-value
Superfamily GAS2 domain-like 1.7e-23
Family GAS2 domain 0.00048
Further Details:      
 
Domain Number 12 Region: 4780-4937
Classification Level Classification E-value
Superfamily Spectrin repeat 2.21e-23
Family Spectrin repeat 0.0025
Further Details:      
 
Domain Number 13 Region: 6687-6804
Classification Level Classification E-value
Superfamily Spectrin repeat 8.9e-23
Family Spectrin repeat 0.0059
Further Details:      
 
Domain Number 14 Region: 6335-6473
Classification Level Classification E-value
Superfamily Spectrin repeat 1.04e-21
Family Spectrin repeat 0.0032
Further Details:      
 
Domain Number 15 Region: 6753-6880,6907-6938
Classification Level Classification E-value
Superfamily Spectrin repeat 8.1e-21
Family Spectrin repeat 0.0069
Further Details:      
 
Domain Number 16 Region: 5667-5810
Classification Level Classification E-value
Superfamily Spectrin repeat 9.42e-21
Family Spectrin repeat 0.0023
Further Details:      
 
Domain Number 17 Region: 5995-6109
Classification Level Classification E-value
Superfamily Spectrin repeat 4.98e-19
Family Spectrin repeat 0.0069
Further Details:      
 
Domain Number 18 Region: 2482-2587
Classification Level Classification E-value
Superfamily Plakin repeat 5.23e-17
Family Plakin repeat 0.0027
Further Details:      
 
Domain Number 19 Region: 5544-5701
Classification Level Classification E-value
Superfamily Spectrin repeat 7.2e-17
Family Spectrin repeat 0.0051
Further Details:      
 
Domain Number 20 Region: 4994-5154
Classification Level Classification E-value
Superfamily Spectrin repeat 2.96e-16
Family Spectrin repeat 0.011
Further Details:      
 
Domain Number 21 Region: 6958-7038
Classification Level Classification E-value
Superfamily EF-hand 9.82e-16
Family Polcalcin 0.057
Further Details:      
 
Domain Number 22 Region: 6253-6367
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000000012
Family Spectrin repeat 0.0054
Further Details:      
 
Domain Number 23 Region: 4492-4611
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000000192
Family Spectrin repeat 0.0067
Further Details:      
 
Domain Number 24 Region: 1154-1284,1311-1337
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000000216
Family Spectrin repeat 0.012
Further Details:      
 
Domain Number 25 Region: 4670-4790
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000000161
Family Spectrin repeat 0.0048
Further Details:      
 
Domain Number 26 Region: 4379-4500
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000000288
Family Spectrin repeat 0.0045
Further Details:      
 
Domain Number 27 Region: 3753-3877
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000000693
Family Spectrin repeat 0.0036
Further Details:      
 
Domain Number 28 Region: 4218-4320
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000101
Family Spectrin repeat 0.011
Further Details:      
 
Domain Number 29 Region: 613-715
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000168
Family Spectrin repeat 0.0041
Further Details:      
 
Domain Number 30 Region: 4000-4136
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000183
Family Spectrin repeat 0.0085
Further Details:      
 
Domain Number 31 Region: 3919-4035
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000264
Family Spectrin repeat 0.004
Further Details:      
 
Domain Number 32 Region: 2218-2318
Classification Level Classification E-value
Superfamily Plakin repeat 0.00000000000863
Family Plakin repeat 0.0012
Further Details:      
 
Domain Number 33 Region: 5894-5998
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000308
Family Spectrin repeat 0.0064
Further Details:      
 
Domain Number 34 Region: 5815-5921
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000000138
Family Spectrin repeat 0.0067
Further Details:      
 
Domain Number 35 Region: 522-612
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000157
Family Spectrin repeat 0.0082
Further Details:      
 
Domain Number 36 Region: 3540-3657
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000017
Family Spectrin repeat 0.01
Further Details:      
 
Domain Number 37 Region: 1355-1471
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000446
Family Spectrin repeat 0.011
Further Details:      
 
Domain Number 38 Region: 3375-3526
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000109
Family Spectrin repeat 0.0064
Further Details:      
 
Weak hits

Sequence:  ENSFCAP00000014141
Domain Number - Region: 4148-4254
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00115
Family Spectrin repeat 0.0078
Further Details:      
 
Domain Number - Region: 5129-5207
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00935
Family Spectrin repeat 0.024
Further Details:      
 
Domain Number - Region: 720-794
Classification Level Classification E-value
Superfamily Spectrin repeat 0.013
Family Spectrin repeat 0.0078
Further Details:      
 
Domain Number - Region: 1039-1146
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0677
Family Spectrin repeat 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFCAP00000014141   Gene: ENSFCAG00000015241   Transcript: ENSFCAT00000015250
Sequence length 7315
Comment pep:known_by_projection chromosome:Felis_catus_6.2:C1:29451653:29656563:1 gene:ENSFCAG00000015241 transcript:ENSFCAT00000015250 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VSFTDERDRVQKKTFTKWVNKHLMKVRKHINDLYEDLRDGHNLISLLEVLSGIKLPREKG
RMRFHRLQNVQIALDFLKQRQVKLVNIRNDDITDGNPKLTLGLIWTIILHFQISDIYISG
ESGDMSAKEKLLLWTQKVTAGYTGIKCTNFSSCWSDGKMFNALIHRYRPDLVDMERVQIQ
SNRENLEQAFEVAERLGVTRLLDAEDVDVPSPDEKSVITYVSSIYDAFPKVPEGGEGISA
TEVDSRWQEYQSRVDSLIPWIKQHTILMSDKSFPQNPVELKALYNQYIHFKETEILAKER
EKGRIEELYKLLEVWIEFGRIKLPQGYHPNDVEEEWGKLIIEMLEREKSLRPAVERLELL
LQIANKIQNGALNCEEKLTLAKNTLQADAAHLESGQPVQCESDVIMYIQECEGLIRQLQV
DLQILRDENYYQLEELAFRVMRLQDELVTLRLECTNLYRKGHFTSLELAPPSTLTTTHLK
AEPLTKGTHSSSTSWFRKPMTRAELVSISSSEDEGNLRFVYELLSWVEEMQMKLERAEWG
NDLPSVELQLETQQHIHTSVEELGSSVKEARLYEGKMSQNFHTSYVETLGKLETQYCKLK
ETSSFRMRHLQSLHKFVSRATAELIWLNEKEEEELAYDWSDNNPNISAKRNYFSELTMQL
EEKQDVFRSLQDTAELLSLENHPAKQTVEAYSAAVQSQLQWMKQLCLCVEQHVKENTAYF
QFFSDARDLESFLRNLQDSIKRKYSCDHNTSLSRLEDLLQDSMDEKEQLIQSKSSVASLV
GRSKTIVQLKPRSPDHVLKSTISVKAICDYRQIEITICKNDECVLEDNSQRTKWKVISPT
GNEAMVPSVCFLIPSPNKDAIEMASRVEQSYQKVMALWHQLHVNTKSLISWNYLRKDLDL
VKTWNLEKLRASAPGECHQVMKNLQAHYEDFLQDSRDSLLFSVADRLRLEEEVEACKTHF
QHLMKSIENEDKEETVAKTYISELKNIRLRLEECEQRLIKRIQSPASSRTDKDARQDSAL
RIAEQERTQEDLQQLRSDLDTVSTKCNSFLHQSPSGSSVPTLRSELNLLVEKMDHVYGLS
TVYLNKLKTIDVIVRSIQDAELLVKGYEIKLSQEEAVPADLSALESHRSTLRHWLSDVKD
KNSVFTVLDEEIAKAKAVAEQLSRLTPERSLDLERCQEKGSQLRERWHRVIVQLETRQSE
LESIQEVLGDYRACHGTLIKWIEETTAQQEMMKPGQAEDSRVLSEQLSQQTDLFAEIEKN
QTKLDQCQKFSQQYSTTVKDYELQLMTYKAFVESQQKSPGKRRRMLSSSDAITQEFMDLR
TRYTALVTLTTQHVKYISDALRRLEEEEKVVEEEKQEHVEKVKELLGWVSTLARNTQSKA
TSSQTKESTDIEKAILEQQVLAEELTTKREQVSEAIKTSQIFLAKHGHKLSEKEKEQISE
QLNDLNKAYHDLCDGSANQLQQLQSQLAQQTEQKGCRAVAGVIDLGTVEIFPIFKAMQKG
LIDQDTGLVLLESQVIMSGLIAPETSEKLSLEEGLARNLINPQVYQQLWELQDALSLISR
LTESKGLPSMVEAIEKKIISERIGLKVLEAHLATGGFSFPPNEGCVNLEEAFHQGLISAR
LHSVLESYLKSSKNLIDPNTAEKISLLDLTQRCIVHQESGLKLLPVKQLAGGMVSLKSGR
KVSVFRAVQEGLIDRQVTVRLLEAQLFAGGIVDPRTGHRLTVEEAVRHNLIDQDMACAIL
IRQLQTGGIVDTITGHRLTIDEAVSNDLVAAKIALVILESLWSFMGLLWPESGEILPITD
ALEQGIVSTELAHKILSGRQHIKALFLPASTEVWSWRKAVEDGMLDKDLVNNLKSICIPD
VMPHMQLADYSERSKLNINPGAVGLPHSRCQTEGVVSHGERLLFQLMTHSYINVQDGQRL
LLVDDELLETLTARGEYQASPPEVFEIGHQRLESPKGLQELVNVKTTEMFCDGLSVKPRE
LQISSQNKDYPTQADCNEAKGKRTTMETEGSSVENSERELFVGEQKVRNPNVDSLMVLDK
VQSELKGQLLGTKKEELTGMSTREKVSRGFLLTVPTEEAEAVTLAVGKEPFSVETPKEEW
RNSRKASFLCQTEQANTLETEISGETGRLLLKPQSEKPQFQIKKTLDLESELKSEDDMNI
HTLDKQKTLNKTFLGRDDPKHNPEGHSIAGGSTMTLEKTDAEDHGHETSLPCSHPSELLP
EATLNTLSAQLLDGGIIHGQTGQKLLLNEAIAQGIVPSHTAVKLMGKLNMFRGFFDSQTC
ESLTTEEVIDEGLMDEKLLHNVLRADKAISGVLDPRSHTLCSVREAVAMGLLDTQTALRI
LEGQVVTGGIVDLKRQKVSVTLASNLGLVDSADETELINLEKASKGRDAEKTVRERFISL
QMETTGILDPESKAPLTVMQSIDRGLLEREEAVQLLTKQVADGGIIHHTSGMRLSVDNAF
EHGIIDEDLAKQLRKVENLSLHRFFHPETKETISLSEAIKLELVNPDLKREIQEIQALPG
SFVDHISGQRLTLAEAEKEGLLTNEAILSSGMMYGIVDPENYRIVPYSELVKKCKIDIES
GQRYLEVIPFSDIKDGASDKVLTLSQATQLGKVDFVSTLKVLEAQANTGGIIDTATGKRL
TLASALEQKLVDENMVKIIASHQVLNGGIVDIFNGQRVTLKEAIEKRLISPELAAMIQVD
PLESCSHGTQIEKQDGIEVCEIEKEFLRKEMLVVCNQTAGMSCGKGASEKLFQIASQTVQ
GKVQTRVSDGGQAKKSMEISLQEMECKDQDKKRVSPDAEESVGIVSPGDHKGTLLGQGSV
TLSRSEAHDFKFKEVASNDVETNTNEEQETVGAQIEITSHMKWSTSGPDSREIRENQERI
ISEVQESDYETSGRLLSEQVMQKSMNTREKSKRKEREMNLEESVETHKPVLSKEKLNQET
IVTADQGSTVENPPVEIAISEKEAGRELEFSIICKDENSSPMIPKGISVNQDVLTFFKPN
QVSEGEVKNLNLCLTLKAEENFSQITCGAQSEPFSSMTPGPKGLHYQELVGKTQVAGRSQ
ISETNKPLQGTIRPETNDYQDSCVTFKTKETKDLIRSSNGYKERSYQEVPSDSTRTLKLE
ESTVSRVDPKEVSYLEVSDKKDFYHQDSKSDNEICGILASKIVTTQEITGEKFLEMSSPT
VTDVEAASFEGIVTQGNPRVLVSLLPEKLFKDVSQKERTGQQDAAISPIIAETSEENPVP
LIYPTMKMDERTPQEELRESPGGEQTAFTTTPGGKGHEGVNPEPFRATKNVFNRQLCLEH
DEKLVSYLSLLRDIEMRTKQIQPLDLNLAELQDLLCQAKVLDSELKDLSTLVHQQLERVN
QIIISQPQEVPAQLLKALEKDAKNLQKSLSSVSDTWSSRLFHLQSAMEVQKTKVLSQREQ
LDGRLQDLRDWVGDTNLILNSKEYNDDTNADSLNHCLQRYEDLKQPMADRKSQLDALAFD
IQFFISEHAQDLSPQQNRQMLRLLNELQRSFQDLAEQATAQMDALQGRFNKSEQAVQVKT
LQKQQNTCYQKLDDLCNWLGQAESTLAGHQGRATQQDLSALQKNQSDLKDLQDDIQNRAT
LFASVVKDIEGFLEENQAKLSPHELTALREKLHQAKEQYEALQERTRVAQKELEEVVTSA
VQQETEKSKAAKELAENRSKIDALLDWVTGVGSTGRQMEQLSGAGLGKGAMDTTDGHRAV
NQALEELDKQCEKMKAHHQELLSQQQNFILATQSAQAFLDQHGHNLTPEERQVLEDRLGE
LKGQYASSLARSEAELKQVQTLRDELQKFLQDHEEFENWLERSERELENMHQGGSCPEAL
PSLLKRQGSFSEDVISHKGDLRFVTISGQKVLDTENSFEEGREASATGMLVKGKLKDATE
RYTALHSKCTRLGSHLNMLLGRYQQFQSTADSLQAWMQACEANVEKLLSDTVASDPGILQ
QQLATAKDKQQLQEELAEHQVPVEKLQKVAHDLMEIEGEPAPDRKHVQETTDSILSHFQS
LSSNLAERSALLQKAIAQSQSVQESLESLLQSIREVEQNLEEEQVTSLSSGVIQEALATN
MKLKQDIARQKSSLEATREMVTRFMETADSTTAAVLQGKLAEVSQRFEQLCLQQQEKESS
LKKLLPQAEMFEHLSDKLQQFMENKSRMLASGNQPDQDIAHFFQQIQELNLEMEDQQENL
ETLEHLVTELSSCGFALDLSQHQDRVQNLKKDFTELQKTVKEREEDASSCQEQLDEFRKL
VRTFQKWLKETEGNIPPTETFMSTKELEKQIEHLKDLLDDWASKGSLVEEINCKGTSLEN
LIMEITAPDSQAKTGSILPSVGSSVGSVNGYHTCKDLTEIQCDMSDVNLKYEKLGGVLRE
HQESLQAVLSRMQEVQKEAGSVLQWLESKEEVLKAMDASSSPTKPETVRAQAESNKAFLA
ELEQNSPKIQKVKEALAGLLMTYPNSQEAENWKEMQEELNSRWERATEVTVARQRQLEES
ANHLASFQAAESQLRPWLMEKELMMGVLGPLSIDPNMLTAQKQQVQFMLKEFETRRQQHE
QLNEAAQGILTGPGDVSPSTSQVQKELQSINQKWIELTDKLNSRSSQIDQAIIKSTQYQE
LLQNLSEKVKAVGQRLSSQSAISTQPEAVKQQLEETSEIRSDVEQLDHEIKEAQTLCDEL
SVLIGEQYLKDELKKRLETVALPLQGLEDLAADRMNRLQAALASTQQFQQMFDELRTWLD
DKQSQQAKNCPISAKLERLQSQLQENEEFQKSLNQHSGSYEVIVAEGESLLLSVPPGEEK
KTLQNQLVELKSHWEELSKKTADRQSRLKDCMQKAQKYQWHVEDLVPWIEDCKAKMSDLQ
VTLDPVQLESNLLRSKAMLSEVEKRRSLLEILNSAADILINSSETDEDDIRDEKAGINQN
MDSITEELQAKTGSLEEMTQRLKEFQESFKNIEKKVEGAKHQLEIFDALGSQACSNKNLE
KLRAQQEVLQTLEPQVDYLRNFTQGLVEDAPDGSDASQLLHQAEVTQQEFLEVKQRVNSG
CMTMENKLEGIGQFHCRVREMFSQLADLDDELDGMGAIGRDTDSLQSQIEDVRLFLNKIQ
ALRLDIEASEAECRQMLEEEGTLDLLGLKRELEALNKQCGKLTERSRARQEQLELTLGRV
EDFYRKLKALNDMTTAAEEGEALQWVVGTEVDLINQQLADFKMFQKEQVDPLQMKLQQVN
GLGQGLIQSAGKNCDVQGLEHDMEEINARWNTLNKKVAQRIAQLQEALLHCGKFQDALEP
LLSWLADTEELIANQKPPSAEYKVVKAQIQEQKLLQRLLDDRKATVDMLQAEGGRIAQSA
ELADREKITAQLEGLESRWTGLLNKAAARQKQLEDILVLAKQFHETAEPISDFLSVTEKK
LANSEPVGTQSAKIQQQIIRHKALNEEIINRKKNVDQAIKNGQALLKQTTGEEVLLIQEK
LDGIKTRYADITVTSSKALRTLEQARQLATKFQSTYEELTGWLREVEEELAASGGQSPTG
EQIPQFQQRQKELKKEVMEHRLVLDTVNEVSRALLELVPWRAREGLDKLVSDANEQYKLV
SDTVGQRVDEIDAAIQRSQQYEQAADAELAWVAETKRKLMALGPIRLEQDQTTAQLQVQK
AFSIDIIRHKDSMDELFSHRGEIFGTCGEEQKAILQEKTESLIQQYEAISLLNSERYTRL
ERAQVLVNQFWETYEELSPWIEETRALIAQLPPPAIDHEQLRQQQEEMRQLRESIAEHKP
HIDKLLKIGPQLKELNPEEGEMVEEKYQKAENLYAQIKEEVRQRALALDEAVSQSAQIAE
FHDKIEPMLETLENLSSRLRMPPLIPAEVDKIRECVSDNKSATVELEKLQPSFEALKRRG
EELIARSQGADKDLAAKEIQDKLDQMVFFWEDIKARAEEREIKFLDVLELAEKFWYDMAA
LLTTIRDTQDIVHDLESPGIDPSIIKQQVEAAETIKEETDGLHEELEFIRILGADLIFAC
GETEKPEVKKSIDELNNAWENLNKTWKERLEKLEDAMQAAVQYQDTLQAMFDWLDNTVIK
LCTMPPVGTDLNTVKDQLNEMKEFKVEVYQQQIEMEKLNHQGELMLKKATDETDRDIIRE
PLTELKHLWENLGEKIAHRQHKLEGALLALGQFQHALEELMSWLTHTEELLDAQRPVSGD
PKVIEVELAKHHVLKNDVLAHQATVETVNKAGNELLESSAGDDASSLRSRLETMNQCWES
VLQKTEEREQQLQLTLQQAQGFHSEIEDFLLELTRMETQLSASKPTGGLPETAREQLDTH
MELYSQLKAKEETYNQLLDKGRLMLLSRDDSGSGSKTEQSVALLEQKWHVVSSKMEERKS
KLEEALNLATEFQNSLQEFINWLTLAEQNLNIASPPSLILNTVLSQIEEHKVFANEVNAH
RDQIIELDQTGNQLKFLSQKQDVVLIKNLLVSVQSRWEKVVQRSIERGRSLDDARKRAKQ
FHEAWKKLIDWLEDAESHLDSELEISNDPDKIKLQLSKHKKQEFQKTLGGKQPVYDTTIR
TGRALKEKTLLPDDTQKLDNLLGEVRDKWDTVCGKSVERQHKLEEALLFSGQFMDALQAL
VDWLYKVEPQLAEDQPVHGDLDLVMNLMDAHKVFQKELGKRTGTVQVLKRSGRELIENSR
DDTTWVKGQLQELSTRWDTVCKLSVSKQSRLEQALKQAEEFRDTVHMLLEWLSEAEQTLR
FRGALPDDTEALQSLIDTHKEFMKKVEEKRVDVNAAVAMGEAILAVCHPDCITTIKHWIT
IIRARFEEVLTWAKQHQQRLETALSELVANAELLEELLAWIQWAETTLIQRDQEPIPQNI
DRVKALIAEHQMFMEEMTRKQPDVDRVTKTYKRKNIEPAHAPFIEKSRSGSRKSLSQSTP
PPMPILSQSEAKNPRINQLSARWQQVWLLALERQRKLNDALDRLEELKEFANFDFDVWRK
KYMRWMNHKKSRVMDFFRRIDKDQDGKITRQEFIDGILASKFPTTKLEMTAVADIFDRDG
DGYIDYYEFVAALHPNKDAYRPTTDADKIEDEVTRQVAQCKCAKRFQVEQIGENKYRFGD
SQQLRLVRILRSTVMVRVGGGWMALDEFLVKNDPCRARGRTNIELREKFILPEGASQGMT
PFRSRGRRSKPSSRAASPTRSSSSASQSNHSCTSMPSSPATPASGTKVIPSTGSKLKRPT
PALHSSRTSLAGDTSNSSSPASTGARTNRADPKKSASRPGSRAGSRAGSRASSRRGSDAS
DFDLLETQSACSDTSESSAAGGQGSSRRGLNKPSKIPTMSKKTTTASPRTPGPKR
Download sequence
Identical sequences ENSFCAP00000014141

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]