SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSFCAP00000014180 from Felis catus 76_6.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFCAP00000014180
Domain Number 1 Region: 584-658
Classification Level Classification E-value
Superfamily VHP, Villin headpiece domain 1.44e-28
Family VHP, Villin headpiece domain 0.0000407
Further Details:      
 
Domain Number 2 Region: 179-241
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 3.51e-16
Family LIM domain 0.0038
Further Details:      
 
Domain Number 3 Region: 107-144
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 7.02e-16
Family LIM domain 0.0006
Further Details:      
 
Domain Number 4 Region: 55-112
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.00000000000000607
Family LIM domain 0.001
Further Details:      
 
Domain Number 5 Region: 237-272
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.0000000000000102
Family LIM domain 0.001
Further Details:      
 
Domain Number 6 Region: 146-178
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.000000285
Family LIM domain 0.012
Further Details:      
 
Domain Number 7 Region: 20-48
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.0000162
Family LIM domain 0.034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFCAP00000014180   Gene: ENSFCAG00000015291   Transcript: ENSFCAT00000015295
Sequence length 658
Comment pep:known_by_projection chromosome:Felis_catus_6.2:B1:202063681:202163204:1 gene:ENSFCAG00000015291 transcript:ENSFCAT00000015295 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PPAVSEPQAAHSPLEKSPSTAILCNTCGNVCKGEVLRVQNKYFHIKCFVCKAXGCDLAEG
GFFVRQGEYICTRDYQRLYGTRCFSCDRFIEGEVVSALGKTYHPDCFVCAVCRLPFPPGD
RVTFNGKECVCQKCSLPKTAGGSVHLSQGLWSCGGCGTEIKKGQSLVALDKHWHLGCFKC
ETCGKQLDAEYISKDGLPYCETDYHTKFGIRCDGCEKYITGHVLEAGEKHYHPLCALCVR
CGRMFAEGEEMYLQGSSIWHPACRQAARTEDKNKETRSSSESIISVPASSTSGSPSRVIY
AEAQGPLRDSQVLRSLPRLQSVRKAERTGVYGTSRAVEHQCGNLAGEGEQSPQVLSPTPT
EGDQDDRSYKQCRTSSPSSTGSVSLGRYTPTSRSPQHYSRPAGTVSVGTSSCLSLSQHPS
PTSVFRHHYIPYFRGGSESGRSTPSLSVLSDSKPPPCTYQQAPRHFHVPDTGVKDNIYRK
PPIYKQHAARRPDGEDSSFEQDNRKQKTSWLILKGDADTRTNSPDLDSQSLSLSSGTDRD
PLQTMQGDNFYSRSPYSKSDPLPGHGKNGLDHRNANLAPCGADPDASWGTREYKVYPYDA
LIVTNRIRVKLPRDVDRTRLERHLSPEEFQEVFGMSVQEFDRLALWKRNDLKKKALLF
Download sequence
Identical sequences ENSFCAP00000014180

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]