SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSFCAP00000014264 from Felis catus 76_6.2

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSFCAP00000014264
Domain Number - Region: 146-246
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00827
Family Spectrin repeat 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFCAP00000014264   Gene: ENSFCAG00000015383   Transcript: ENSFCAT00000015387
Sequence length 527
Comment pep:known_by_projection chromosome:Felis_catus_6.2:B1:185379653:185442549:1 gene:ENSFCAG00000015383 transcript:ENSFCAT00000015387 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VSEQMFSGEKMSAGLNGQYLVCKRKLESKKEALLILSKELDTCQQERDQYKLMANQLRER
HQSLKKKYRELIDGDPSLPPEKRKQANLAQLLRDSQDRNTHLGEEIKELQQRLAEVQGDN
KLLRMTIAKQRLGDEEIGVRHFAAHEREDLVQQLERAKEQIESLEHDLQASVDELQDVKE
ERSSYQDKVERLNQELNRILGGHENRLIDVDALCMENRYLQERLKQLHEEVNLLKSNIAK
YKNALERRKNSKGQSKSSSSALTGVLSAKQVQDLLSEDHGCSLPATPQSISDLKSLATAL
LETIHEKNMVIQHQRQTSKILGNRVAELEKKLRTLEVSGLWSLPGGKDTILFGDPAVPTI
QRSRSPLLKFIEQPAENKTNSKDGEIQTQERDESRAATEALTAPEDAGRPAISSPANQSH
GNQCNPFHPSLPQVPSEEEEMNRLGREITKLTEAHAEAEPEGARRAGLGEAQRNEMGTAT
LGLTSRGEAPKSCQGPIESSQAAAEASTAEDSKETLEGAGRRSPVKT
Download sequence
Identical sequences ENSFCAP00000014264

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]